KEGG   Dehalobacter sp. CF: DCF50_p2237Help
Entry
DCF50_p2237       CDS       T02279                                 

Definition
(GenBank) Energy-conserving hydrogenase (ferredoxin), subunit A
  KO
K14086  ech hydrogenase subunit A
Organism
dec  Dehalobacter sp. CF
Brite
KEGG Orthology (KO) [BR:dec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    DCF50_p2237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proton_antipo_M Proton_antipo_N UPF0154
Motif
Other DBs
NCBI-ProteinID: AFV06240
UniProt: K4L410
Position
complement(2298624..2300501)
Genome map
AA seq 625 aa AA seqDB search
MNTLLTTMIGLIVFPLIVAILLLVFGWYPARRVIVQLSTIVIALGTVYLTVQGLSKGSVF
FPFASEPTGQIMLGIEGLIALFIIYMGIRYKKYLASVLALLQEGLMFYFELTYGHNLHAD
NNLFIDEFSIIMALIIGIIGGLICIYSIRYMKDYHHHNPDVPNRTPFFFFVMFVFLAAMF
GLVFANNLIWLYFFWEITTLCSFLLIGYSKTVIAMNNSFRAIIMNLIGGLGFAIAIVFLA
TQADVIELNKLQGVAQALILLPAALLSFAGITKSAQMPFSSWLLGAMVAPTPTSALLHSS
TMVKAGVYLIIRLSPVLLGTNVGLMVALVGAFTFLTASCLAIAQDESKRVLAYSTVANLG
LIVACAGIGTAELVWAAIMLVIFHAVAKSLLFLAVGSVEHKIGDRNIEIMDSLITKVPTL
AIMIVIGIFGMFLAPFGMLISKWAALEGLIKANALLTVFIAFGSAATVLFWGKWLGKIVM
VKQKPQDFDSKVPRLEKYSLGILAFLTIAVCVLFPFISTKFIIPFLNSTNTIISQGNIFI
MLIMMVMIILMPLSLWFYKDVHYTGIYMGGANAGKESYYGAMHVDRELSMRSLYLANYFG
EHRLNKIAIGLSTTLIILMIGVVAL
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgctattgaccaccatgatcggcttaatcgttttcccgctgatcgtggctatt
ctacttctggtttttgggtggtatcctgccagaagagttattgtccaactttcgacgatc
gtaatcgctctcggtacagtgtatctcacagttcagggactgtcgaaaggaagcgtgttt
tttccgttcgcgtccgaaccaacaggccaaattatgctggggatcgaaggacttattgcc
ctgttcattatttatatgggaatacgctacaaaaagtatctggcatcggtactggccttg
ctgcaagaaggactgatgttctattttgaactgacatacggacacaatctccatgccgat
aataatctgttcatcgatgaattctctattattatggccctgatcatcggtatcatcggc
ggactgatctgtatctattcgatccgctatatgaaagattatcatcatcataacccggat
gtcccaaatcgcacgcctttctttttcttcgttatgtttgtatttctggccgcaatgttt
ggcctggtatttgccaataatctaatatggctgtactttttctgggaaatcaccacactt
tgttccttccttttgatcggttacagtaagacagtgattgcaatgaacaactcattccgg
gctatcattatgaacctgattggcggtttaggctttgcaattgccatcgtctttctcgcc
acccaggctgatgtcattgaactcaacaaactacagggagtcgcccaggcattgatcctg
ctaccggcagcccttttgagctttgccgggatcaccaaatcggcgcagatgccgttttct
tcctggctcttaggcgcgatggtcgccccgacaccaacctcggccttgctgcactccagt
acgatggtcaaagccggagtctatctaattatccgtttatcgcctgttttactcggcacc
aacgttggtctgatggtcgccttggtcggcgccttcactttcctgacagcatcctgcctg
gcgattgcccaggatgagtccaaacgcgtcctggcatattccacggttgctaatctgggt
ctgatcgtcgcttgtgccggaatcggcaccgctgagttggtatgggccgccattatgctg
gtgatcttccatgccgtagccaagtctctgctgttcctggctgtcggttccgttgaacat
aaaatcggtgaccgcaacattgaaatcatggacagtctgattaccaaagtaccaaccctg
gcgataatgattgttatcggtattttcggcatgtttctggcaccgtttggaatgttgatc
agcaaatgggctgctttggagggactcatcaaagccaatgccctgcttacggtgtttatc
gctttcggcagtgccgcaaccgtgttgttctggggcaaatggctggggaaaattgttatg
gttaagcaaaaacctcaagattttgacagtaaagttccgagactggagaaatactccctg
ggaatcctggcttttctgaccattgcagtctgcgttctgttcccgttcatttctaccaaa
ttcattatcccgttcttaaacagcacaaatacgatcatttcccagggcaacatttttatc
atgttgatcatgatggtcatgatcatcttaatgccgcttagcctgtggttttataaagat
gttcattacactgggatttacatgggtggagccaacgccggtaaggaaagttattacgga
gcgatgcatgtggacagggaactgagcatgcgcagtctgtatctggccaactattttggc
gaacatcggctgaataaaattgcgataggcttatcaacaacattaatcatcttgatgata
ggagttgtggcactgtga

DBGET integrated database retrieval system