KEGG   Dehalobacter sp. CF: DCF50_p2323Help
Entry
DCF50_p2323       CDS       T02279                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00670  One carbon pool by folate
dec01100  Metabolic pathways
dec01120  Microbial metabolism in diverse environments
dec01200  Carbon metabolism
Module
dec_M00377  Reductive acetyl-CoA pathway (Wood-Ljungdahl pathway)
dec_M00618  Acetogen
Brite
KEGG Orthology (KO) [BR:dec00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DCF50_p2323
Enzymes [BR:dec01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     DCF50_p2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR PK
Motif
Other DBs
NCBI-ProteinID: AFV06326
UniProt: K4L6T6
Position
complement(2389747..2390622)
Genome map
AA seq 291 aa AA seqDB search
MKISELFKTGKPTLSFEYFPARTEKNAETLEKTLGVLASLDPSFVSVTFGAGGSTREGSY
ELVKKLKQEKKLEVVAYLAAYGLRLDEVAAVLDAYRDLGIENILALRGDLGKDGAKEIPA
DTIHYAYELVTFAKKNYNFCIGVAGYPEGHLEAPSLEKDIEYLRYKVDQGADFVIANFFH
DNIYFYHLLERCQKSGITVPVIPGLMPVYSVKMMEMLAANCGAIIPEQLKKGIASLPEGD
ADALVEFGIQYAAAQCEELLREGACGLHFYTMDRSESTAGIVKILREKGLL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatctgaattattcaaaaccggcaagccaaccttgtcttttgaatattttccc
gcacggacggaaaaaaatgcggaaacactcgaaaagacgcttggtgtcttagcgagcctt
gatccgagttttgtttcggtcaccttcggggcaggtgggtcaacaagggaaggatcttat
gaactggtcaagaaattgaagcaggagaaaaagctcgaagttgttgcttatctcgcggct
tatggtttaaggctggacgaagtggctgcagtgctggatgcttaccgggaccttgggatt
gagaacatcttggcactgcgtggagacctgggcaaagacggagcgaaggaaattcctgcg
gataccattcactacgcttatgaactcgtaacgtttgccaaaaagaattataacttttgt
ataggggtagcaggatatcccgaaggtcatcttgaggcgccaagcttggaaaaggatatt
gaatacttaaggtataaggtggatcaaggcgcggattttgtcattgccaacttctttcat
gacaatatttacttctatcatttgctggagcgctgccaaaagagcggcattactgttcct
gttattcctggcctgatgcctgtctacagtgtcaaaatgatggaaatgcttgcagcaaac
tgcggggccatcataccggaacaattaaaaaaaggaattgcttcattgccggaaggcgat
gcggatgccctagtggaatttggtattcaatacgctgcggcacagtgcgaagaactcctc
cgagaaggagcctgcggcttgcatttctacactatggacagaagcgaatcaacagccggt
attgttaaaatcctgcgagagaagggcttgctgtaa

DBGET integrated database retrieval system