KEGG   Dehalobacter sp. CF: DCF50_p277Help
Entry
DCF50_p277        CDS       T02279                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00450  Selenocompound metabolism
dec00970  Aminoacyl-tRNA biosynthesis
dec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dec00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DCF50_p277
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DCF50_p277
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dec01007]
    DCF50_p277
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dec03016]
    DCF50_p277
Enzymes [BR:dec01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DCF50_p277
Amino acid related enzymes [BR:dec01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DCF50_p277
Transfer RNA biogenesis [BR:dec03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DCF50_p277
 Prokaryotic type
   Other AARSs
    DCF50_p277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AFV04283
UniProt: K4LCW5
Position
281719..283716
Genome map
AA seq 665 aa AA seqDB search
MKYYITTPIYYPNSSPHIGTAYTTIAADAMARLRRMKGDDVYFLTGTDENAQKIVRTAEN
AGMDPLTYVDGIVDKFKEFWRLLDISNDDFIRTTEERHAKVVQQIFTRLYEKGDIYKSEY
EGWYCTPCETFWTENKLVDGKCPNPDCGRNVELLKEESYFFRMSKYSGRLLQYIQDHPDF
IQPASRRNEMIRFIEGGLEDLCVSRTTFQWGIKVPFDPKHVVYVWLDALINYISALGYPD
GEKYKTYWPANVHLVGKDIVRFHTIIWPIILMALDLPLPEKVFGHGWFLSKEGGKISKSR
GNVQDSFQLIQRYGADPIRYFLLRELQYGLDGTFSEDDLVEKLNSDLANDLGNFVSRTLA
MVVKYRNGIVPEPGEDTDLEREIRDLSSRVKQGTEEKMLACDTAAALEVIWQFVSRCNKY
VDETAPWNLAKSEDNQDRLDTVLYTFMECIRILGILCAPFMPGVPRKIKPLLGDTDFFKD
WEQADSWNVIQPGTAIRKGEAIFPRIDVSAYLEQVNSEIERCVTQVQGNTDHQQEVNLEV
SPSQPEDSQHMAEMAPLKEEISIEEFAKMDFRVVKVLQAEKVEKADKLLKLEVEMGGERR
TIVSGIAQHYSPEELVGKKVILVANLKPAKLRGIMSQGMILAASQDGELEVLNVQKDLPT
GAQVK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatattatattaccacacctatttattatcccaattccagtcctcatatcgggact
gcgtacacgactattgctgcggatgcgatggcccgtctgcgaagaatgaagggcgatgat
gtctattttttgaccgggacggatgagaatgcgcaaaaaattgtacggactgctgaaaat
gccgggatggatccgcttacatatgttgacggaatcgtcgataaatttaaggaattctgg
agactgcttgacatttccaatgatgattttatccggacaacagaagaacggcatgccaaa
gtcgtacagcaaatatttacaaggctttatgaaaagggcgatatttacaaatccgaatac
gaaggttggtactgtacaccttgtgaaactttctggacagagaacaaacttgttgacgga
aaatgtccgaatccggattgtggaagaaatgtggaacttctgaaagaagaaagttacttt
ttcaggatgtccaaatacagtggcagactgctgcaatatattcaggaccatcccgatttt
attcagcctgcttcgagaagaaatgaaatgatccggtttattgaaggcgggcttgaagat
ctctgtgtatcgcgtacgaccttccagtggggcatcaaggtcccttttgatccgaaacat
gtggtctatgtctggctcgatgccctgatcaactatatctctgcgctgggctatcctgac
ggcgaaaaatacaaaacttactggccggccaatgttcatcttgttggcaaagatattgtc
cgtttccataccattatctggccaattattttgatggcgcttgatcttcctttgcccgag
aaggtttttggacacggatggttcttaagtaaagaaggtggaaaaatatccaagtcaaga
ggaaacgttcaggattcgtttcagctgattcagagatatggtgctgatcccattcggtat
ttcctgttaagagaactacagtatgggttggacggtactttctcagaggacgatctggtc
gaaaaattaaacagtgatctggcgaatgatcttggaaattttgtgtctcgcaccttggcc
atggtcgtaaaataccggaatggaattgtcccggaacccggagaagataccgatctggag
agggagatcagagatttaagcagcagggtaaaacaagggacagaagaaaaaatgctggcc
tgtgatacggcggctgcgcttgaggtcatctggcagtttgtcagcaggtgcaataaatat
gtcgatgagacagctccctggaatctggcaaaaagtgaggataatcaggacaggctggat
acggtgctttatacatttatggagtgcattaggatcctaggtattttatgcgcccccttt
atgccgggagtaccgagaaaaatcaaacccctcctgggagatacagatttcttcaaggac
tgggaacaggcagacagctggaatgttattcagccgggcacagccatccgaaagggagaa
gccattttcccgagaatcgatgtctccgcatatcttgagcaggtcaattctgaaatagaa
aggtgtgtcacacaggtgcaggggaatacagaccatcaacaagaagtaaatctagaagtc
agtccttcgcagccggaagattcgcagcacatggcggagatggctccgctcaaggaagaa
atcagcattgaagagtttgccaaaatggattttagggttgttaaagtgctgcaggcagaa
aaagtagaaaaagccgacaaactgttaaaactggaagtagaaatgggtggggagcgtaga
acgattgtatctggtattgcccagcattacagccccgaagagcttgtcggcaaaaaggtt
attctggttgcgaatcttaagcctgccaagctccgcggaatcatgtcccagggaatgatt
ctggcagcgtcgcaggacggagagctggaggtgcttaatgttcagaaagatcttccgaca
ggggctcaggtcaaatga

DBGET integrated database retrieval system