KEGG   Dehalobacter sp. CF: DCF50_p285Help
Entry
DCF50_p285        CDS       T02279                                 

Definition
(GenBank) 5-methyltetrahydrofolate:corrinoid iron-sulfur protein methyltransferase
  KO
K15023  5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase [EC:2.1.1.258]
Organism
dec  Dehalobacter sp. CF
Pathway
dec01100  Metabolic pathways
dec01120  Microbial metabolism in diverse environments
dec01200  Carbon metabolism
Module
dec_M00377  Reductive acetyl-CoA pathway (Wood-Ljungdahl pathway)
dec_M00618  Acetogen
Brite
Enzymes [BR:dec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.258  5-methyltetrahydrofolate:corrinoid/iron-sulfur protein Co-methyltransferase
     DCF50_p285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AFV04291
UniProt: K4L142
Position
complement(292258..293043)
Genome map
AA seq 261 aa AA seqDB search
MDRFLVIGERIHCISPVIRQAIADRNPAPILQRAKEQLDAGAVYLDLNIGPAERDGEEVM
AWAVQLLQNEFDNVPICLDTANKKAIEAGIRVYNRSKGKPIINSADAGPRLGLLEVAAAN
DAMAIALCAKDGIPSDVEERITYCTEMLEKAMMLGIDPMDLLFDPLFLVIKGMQEKAPEV
LETIRQITEMGLRTNAGLSNVSNGAPKHVRPIIDATYCAMAMQCGLTAAIVNPCDHRLME
TIKTCDMIKGNMLYADSYLEL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggatagatttttagtcattggtgaaagaatccactgtatttctccggtcattcggcag
gccatcgctgaccgtaatcctgccccgattctccagagggctaaagaacagcttgatgcc
ggcgctgtttacctcgacctgaatattggacctgctgaaagagacggcgaagaagtcatg
gcctgggccgttcagcttctgcagaatgaatttgataatgttccgatttgtttggataca
gccaataaaaaagcaattgaagccggtatcagagtctacaaccgttccaaaggcaaaccg
attatcaattctgccgatgccggtccgagactggggctcttagaagtcgccgccgccaac
gatgccatggctattgccctgtgtgctaaagacggcattccttctgacgttgaagagcgc
atcacctactgcaccgaaatgctggaaaaagcaatgatgctcggtatcgacccgatggat
ctcttatttgacccgctgtttctggtcatcaagggcatgcaggaaaaagcaccggaagtc
cttgagaccattcgccagatcacggaaatgggtctcagaaccaatgctggattaagcaat
gtctccaatggtgctccaaaacatgtccgtccgatcattgacgccacctattgtgcaatg
gccatgcaatgcggtctgactgcagccattgtaaacccttgcgaccacaggcttatggag
acaatcaaaacctgtgacatgattaaaggcaatatgttatatgccgattcctacctggag
ctatga

DBGET integrated database retrieval system