KEGG   Dehalobacter sp. CF: DCF50_p393Help
Entry
DCF50_p393        CDS       T02279                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00020  Citrate cycle (TCA cycle)
dec00640  Propanoate metabolism
dec00660  C5-Branched dibasic acid metabolism
dec01100  Metabolic pathways
dec01110  Biosynthesis of secondary metabolites
dec01120  Microbial metabolism in diverse environments
dec01130  Biosynthesis of antibiotics
dec01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DCF50_p393 (sucC)
   00640 Propanoate metabolism
    DCF50_p393 (sucC)
   00660 C5-Branched dibasic acid metabolism
    DCF50_p393 (sucC)
Enzymes [BR:dec01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DCF50_p393 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 GARS_A CPSase_L_D2 Citrate_bind ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFV04399
UniProt: K4L1S6
Position
410504..411778
Genome map
AA seq 424 aa AA seqDB search
MAKFLEYQGKEWLAKAGIPVPKGRSASSPEEAQQAAEWIGKSVAVKGQVQAGGRGKAGIV
KLVVTPSEASAAAAEILAKTVKGLPVRQVLIEEKLAIKKEYYCSFVINNARDARCPMLMF
SSEGGMDIESVPEELIFKMNIDPIFGLQIYDAIDFCVRAGIPNKELSKFASFLTKLSQVY
KKYDCQTLEINPFVMTEDGSLICADCKMEIDNSSVGRHPEFGIKIARDLPGEVTELDMIG
WSIEETDARGTGFLMNMGYDEVSPGYIGYHPIGGGSAMMGLDALNQVGLKPANYADTSGN
PVGSKIYRVAKCVLSQPNIDGYLLGGFMMANQEQWHHANAIVKVLWEELPKRPGLPCVLL
LCGNREDESMEILRKGLAELMTPDGIGKRIEIYGKEHVTDTKFIGQRLLALAKEYRAEKD
AQGK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttctagagtatcaaggtaaggaatggcttgccaaagcgggaatacccgta
ccgaagggcaggtcggcatcttctccggaagaagcgcagcaagcggcagaatggattggc
aagtccgtagctgtcaaaggtcaggtccaggcaggaggacgaggaaaagccggtattgta
aaactggtcgtgactccgtccgaagcttcggcagcagcagctgaaatactggcaaagaca
gtcaaaggactccctgtcaggcaagttttaattgaggagaaactggcgatcaaaaaagaa
tactattgttcatttgtcattaacaatgcaagagacgcccgctgcccgatgctgatgttc
agctcagaaggcggtatggatattgaaagtgttcctgaagaactaatttttaagatgaat
atcgaccctatttttggtctgcagatttacgatgcgatcgatttttgtgtccgagctggc
attccaaataaagaattgagtaagtttgcttctttcctgacgaagctgtcccaagtctac
aaaaagtatgactgccagaccctggagatcaatccgtttgtcatgacggaggatggaagc
ctgatctgtgcggactgcaaaatggagattgataacagctctgtgggccgtcatccggaa
tttggcattaaaattgcccgcgatttgcctggtgaagtcaccgaactcgatatgatcggc
tggagcattgaagaaacagatgcccgtggaaccggcttcctgatgaatatgggttatgac
gaagtaagccccggctatattggctatcacccgatcggcggcggttcggcgatgatggga
cttgatgcgctgaatcaggtaggactcaagcctgccaactatgccgatacgagcggcaat
cctgttggatcaaaaatctatcgcgttgccaagtgcgtactatcgcagcccaatattgac
ggttatcttcttggcggctttatgatggcgaatcaggagcaatggcaccatgccaatgcg
attgtcaaagtactgtgggaagagcttccgaagaggcccggcctgccttgcgttctgtta
ctctgcggcaatcgcgaggatgaatccatggagattctacgcaagggtctggcagagctg
atgactccggacggaattggcaaaagaattgaaatatacggaaaagagcatgtcacggat
actaaatttattggtcaaagacttctggctctagccaaagaatacagggcagaaaaagat
gctcaaggaaagtag

DBGET integrated database retrieval system