KEGG   Dehalobacter sp. CF: DCF50_p593Help
Entry
DCF50_p593        CDS       T02279                                 

Definition
(GenBank) ADP-ribosylglycohydrolase
  KO
K05521  ADP-ribosyl-[dinitrogen reductase] hydrolase [EC:3.2.2.24]
Organism
dec  Dehalobacter sp. CF
Brite
KEGG Orthology (KO) [BR:dec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DCF50_p593
Enzymes [BR:dec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.24  ADP-ribosyl-[dinitrogen reductase] hydrolase
     DCF50_p593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADP_ribosyl_GH
Motif
Other DBs
NCBI-ProteinID: AFV04599
UniProt: K4L2C2
Position
599821..600741
Genome map
AA seq 306 aa AA seqDB search
MADLISRARGAMLGVAAGDALGATLEFMNREEIVHTYGRHRDMTGGGFWKLAPGEITDDT
EMTLAAANGILEDPADPVKHVARHFREWSRQEPKCIGNICRMVLQEGIRTEADNEQEWLQ
IAENAHRLSGGRSGGNGSLMRTVPVVIAYHNNLPKMTDLAARLSALTHYDPLAGACVVFY
CKIVRELLLGGELRIVLEKAQADAPFALQMNLSADQMKTSGYVVHTLETALNCVFQTNSL
EEALVMAVNLGGDADTIGAVTGGMAGACYGIENIPSRWLEKLSRRDELLALTDRLLAIGR
GTKIGI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcttatttccagagcaaggggagcaatgctcggggtggcagccggggatgcg
cttggggcaacccttgaatttatgaaccgcgaagaaattgttcatacctatggccgacac
cgggatatgaccggcgggggattctggaaattggcacccggagaaattaccgatgataca
gaaatgacccttgcggcagccaacgggattcttgaagaccctgcagacccagtaaagcac
gtcgcccgtcattttcgggaatggtcccggcaagagcccaaatgtatcggaaatatctgc
cggatggttctgcaggaaggaatccggacagaagcggataacgaacaggaatggctgcaa
atcgctgagaatgcccatcgactcagcggcgggagaagcggcggcaatggttcactgatg
agaacggtcccggtggtcattgcctatcacaataacctgccgaaaatgacggatctagcg
gcaagattatcggctctgacccattatgatccactagcaggagcttgtgtggttttttac
tgtaaaattgtcagggaattgcttttaggcggagaactccgcatcgtgctggaaaaggcc
caggcggatgctccgtttgccctgcaaatgaacttaagtgctgatcaaatgaaaacaagc
ggttacgttgtccatacattggaaactgctttaaactgtgtctttcagaccaattctctg
gaagaagcgctggtgatggccgtaaacctcggaggagacgcggatacgatcggcgcagta
accggcgggatggccggagcctgctatggcatagagaacataccttccaggtggctggag
aagctctcgcgaagagatgaactcttagcgctgacggacaggctgcttgctattggcagg
gggacgaaaataggtatttga

DBGET integrated database retrieval system