KEGG   Dehalobacter sp. CF: DCF50_p733Help
Entry
DCF50_p733        CDS       T02279                                 

Definition
(GenBank) Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00010  Glycolysis / Gluconeogenesis
dec00620  Pyruvate metabolism
dec00640  Propanoate metabolism
dec00680  Methane metabolism
dec01100  Metabolic pathways
dec01110  Biosynthesis of secondary metabolites
dec01120  Microbial metabolism in diverse environments
dec01130  Biosynthesis of antibiotics
dec01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DCF50_p733
   00620 Pyruvate metabolism
    DCF50_p733
   00640 Propanoate metabolism
    DCF50_p733
  Energy metabolism
   00680 Methane metabolism
    DCF50_p733
Enzymes [BR:dec01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DCF50_p733
Lipid biosynthesis proteins [BR:dec01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DCF50_p733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFV04740
UniProt: K4KZS6
Position
complement(752735..754417)
Genome map
AA seq 560 aa AA seqDB search
MNLASRYIGKTDFDSYEDFCANYQVKVPDNFNFAYDIVDEYGRLEPERPALVWCDDHGNE
RIFTFADLKKYSDKTANMLSEAGIRKGDKVMLILRRRYEVYIAILALAKIGAIYIPSSNQ
LTQKDIIYRNNAASIKAIIAYHDPVILDHVEASREESSTLETLFLVGARRPGWVDFDSSM
EAASENWVRPTGADATTNDDTMIIYFTSGTTSMPKMAIQSFTYPLGHIVTAKYWQRVVDG
GLHLTVSDSGWAKFGWGKIYGQWICGAVQFVYDMDKFIPEKLLEMMQKYKLSTFCAPPTI
YRFLLEHNLEKYNLSSIVHCSTAGEPLNPDVFNRFKSITGLSILNGFGQSETTVLVANFE
WLDIYPGAMGKPNPAYKIDVVDENGAPCPPGVEGELVIREADSNKPAGLFCGYYMDETAT
NKVWYDDTYHTGDMAYWDEHGFLWFVGRNDDVIKASGYRISPFEVESALIEHPAVVECAV
TGAPDAVRGTVVKATVVLAKGYTASELLKKEIQDYVKKVTAPYKYPRILEFVDELPKTIG
GKIKRAQIRREDTEKFQDKE
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcgcttcaagatatatcgggaaaaccgattttgattcttatgaagatttttgt
gcgaattatcaagtgaaagtacctgacaattttaattttgcgtatgatatcgtcgatgaa
tatggccgtctggaaccagagcgtccagcgctggtctggtgcgacgaccatggtaatgaa
cggatctttacctttgccgacctgaaaaaatactcggataaaacggcgaacatgttaagc
gaagccgggatccgcaaaggcgacaaagtcatgctgattctgagaaggcgttatgaagtg
tacatagcgattctggctctggccaaaatcggcgcgatctatattccttcttccaatcag
cttacgcagaaggatattatttatcgaaataatgccgcatcgattaaagcgatcattgcc
tatcatgatccggtaattctcgaccatgtcgaagcttccagggaagaatcgtcaacgctc
gaaacgctgtttctagttggggcccggcgtcccggctgggttgattttgacagcagcatg
gaggctgcttccgaaaactgggtccggccaacaggtgctgatgcgacaacgaatgacgac
acaatgatcatctatttcacgtcagggaccacgagcatgcccaaaatggccattcagagc
ttcacctatccgcttggtcatattgtgacggctaaatactggcagcgcgtcgtggacggc
gggcttcaccttacggtttccgattccggctgggctaaattcggctgggggaaaatttac
ggccagtggatttgcggcgcagtgcagtttgtctatgatatggacaagtttatccctgaa
aagcttttggaaatgatgcaaaaatataagctgtccacgttttgtgcaccgccgacaatt
tatcgcttcctgcttgaacacaatcttgaaaaatataacctgtcctcgattgttcactgc
tccacagccggagagcccttaaatccggatgtctttaaccgttttaaaagcattaccggc
ttaagcatcttaaacggatttggccagagcgagacgaccgtgctggttgccaattttgaa
tggctggatatttatccaggagcgatgggcaaaccgaatccagcctacaagattgatgtg
gtcgatgaaaacggagctccatgccctccgggagtcgaaggagaactggttatccgcgag
gctgattccaataagcctgccggattgttctgcgggtactacatggatgaaactgctacc
aataaagtgtggtatgacgatacgtaccacacaggggatatggcctactgggatgaacac
ggctttttatggtttgttggccgcaatgacgatgtcattaaggcttccggctacaggatc
agtccttttgaagttgaaagtgcactaattgagcatcccgcagtcgtggagtgtgctgtt
accggcgcgccggatgccgtcaggggaacggtcgtcaaagcgactgttgtgctggccaaa
ggctatacggcctctgaattgctaaaaaaagagatccaggactatgtcaaaaaggtgaca
gctccgtataaatacccgagaattctcgaatttgtcgacgaactgccgaagacgatcggc
ggcaagatcaaacgcgcccagatccggcgtgaagacacggaaaagtttcaagataaagaa
taa

DBGET integrated database retrieval system