KEGG   Dehalobacter sp. CF: DCF50_p914Help
Entry
DCF50_p914        CDS       T02279                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dec  Dehalobacter sp. CF
Pathway
dec03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dec00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DCF50_p914 (ruvA)
Enzymes [BR:dec01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     DCF50_p914 (ruvA)
DNA repair and recombination proteins [BR:dec03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DCF50_p914 (ruvA)
    RecFOR pathway proteins
     DCF50_p914 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_2 UBA HHH_3 IMS_HHH Transposase_20 HHH_8 HHH_4
Motif
Other DBs
NCBI-ProteinID: AFV04921
UniProt: K4L2V6
Position
complement(963063..963665)
Genome map
AA seq 200 aa AA seqDB search
MIGMLRGTVWTAEADRLVLDVGGVGYLLHVPVSSMVKISQGEETTLHTHLIMREDDVSLY
GFLTRDEKNLFLQLLSVTGIGPKAALSILSAFSVSKIKTAIVCEDVSLLTEVPGIGGKTA
KRIILELKEKIKDVDIKAGTEEDMRSFIPADDTLETLLALGFSRYEARDALVRAEKKGLS
SMEDKLKEALRLLAGPSEHM
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaatgctgcgggggactgtgtggacagccgaagcggaccgcctggtgcttgat
gtcggcggcgtaggctatttgctccatgttccggtaagttcaatggtaaagatcagtcag
ggggaagagactaccctgcatacccatttaatcatgcgggaagatgatgtgtctttgtac
ggttttttaacccgggatgagaaaaatttgtttctgcagctccttagcgtaaccgggatt
ggtccaaaggcagcactgagtattttgtcggctttttctgtcagtaagatcaagacggcg
atcgtctgtgaggacgtttctttattgaccgaagtccccggaatcggcggcaaaactgcg
aagagaatcattctggaactgaaagaaaagatcaaggatgtcgatattaaagccggaacg
gaagaagatatgaggtccttcattccggcagacgatacactggaaaccctgctggcttta
ggcttttcccgctatgaggcccgcgacgcactggtcagggcggaaaagaaaggcttatcc
tccatggaggataagctcaaagaagccctgcgtctgctcgcaggaccgtccgagcatatg
tga

DBGET integrated database retrieval system