KEGG   Dehalobacter sp. DCA: DHBDCA_p919Help
Entry
DHBDCA_p919       CDS       T02278                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ded  Dehalobacter sp. DCA
Pathway
ded00010  Glycolysis / Gluconeogenesis
ded00620  Pyruvate metabolism
ded00640  Propanoate metabolism
ded00680  Methane metabolism
ded01100  Metabolic pathways
ded01110  Biosynthesis of secondary metabolites
ded01120  Microbial metabolism in diverse environments
ded01130  Biosynthesis of antibiotics
ded01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DHBDCA_p919
   00620 Pyruvate metabolism
    DHBDCA_p919
   00640 Propanoate metabolism
    DHBDCA_p919
  Energy metabolism
   00680 Methane metabolism
    DHBDCA_p919
Enzymes [BR:ded01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DHBDCA_p919
Lipid biosynthesis proteins [BR:ded01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DHBDCA_p919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFV01946
Position
complement(969668..971356)
Genome map
AA seq 562 aa AA seqDB search
MIMYEKYIGRHRDDYVTLEDLYKNFKVTCPDDFNFAYDVLDKLAEEKPDQLAMLWVSNSG
EEKRITFAEMKRWSDKTANYFKSLGIKKGDLVLLVLKRSYLFWYAMMALHKIGAVAVQAT
NLLTAKDYIYRCQAAGIKMAVITADGDCTRHFDEAAPECKTVQMKAVTKHKEAGEGWLDF
EAGVEAASDKWERPTGEEATKVTDMLIMAFSSGTTGYPKMVSHDHAYPLGHIMTGIFWHR
VEPGGLHFTISDTGWLKSLWGKMYGQWLGESAIFTYDFDTFNGADILQKLEKYQITTFCA
PPTMYRFMLREDVKNFNLSALKHCCTAGEALNPEVFNQWRQATGLRIFEGFGQSETTVCC
SILYPWVQPRPGSMGMPTPGYQMVVADEDGKEVDPGVTGEICIKAPDYATKTKGLFMGYY
RDEVNTQRSWHDGLYHTGDLAYRDELGFLWYIGRNDDIIKSSGYRIGPFEVESALAEHPA
VLESAVTGVPDPIRGFNVKATIVLNKGYEPSEDMIKELQDHVKKVTAPYKYPRVIEFVTE
LPKTISGKIRRVEIREKDSRSE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgtatgagaagtatattggcagacaccgggacgactatgtcacgctggaagat
ttatataagaattttaaggtgacctgtccggatgattttaactttgcctacgatgtcctt
gataaattggctgaggagaaacccgatcagctggcgatgctctgggtaagcaatagcggt
gaagaaaaaaggattacttttgctgaaatgaaacgctggtctgataagacggcgaattat
tttaagtcacttggcattaaaaaaggagatcttgtcctactggttttaaaaagaagctat
ttgttctggtatgccatgatggccctgcataaaattggcgcagtggccgttcaagcaacg
aacctgctgacggctaaagattatatctatcgctgccaggcggcaggtatcaagatggcc
gtgattaccgcagacggtgattgtacccggcattttgacgaggctgctccagaatgtaaa
acggttcagatgaaagcggttacgaaacataaggaggcaggagagggctggctcgatttt
gaagccggggttgaagctgcgtctgacaaatgggaacgccctaccggcgaagaagcgacc
aaagtcacggatatgctgattatggccttttcctccggcacgaccggctatcccaagatg
gtctcgcatgatcatgcttatcccttaggacatattatgacgggcattttctggcacagg
gtagagcctggcggtctgcatttcacaatctccgacactggatggttgaaatccctctgg
ggcaaaatgtatggccagtggttaggtgaatcagcgatattcacatatgactttgatacc
tttaacggcgcggatattttgcagaaactggagaaataccaaataaccactttctgtgca
ccgccgaccatgtaccgctttatgctgcgggaagatgttaagaacttcaacctgtcggcg
ctgaaacactgctgtaccgcaggagaggccttaaatccggaagtgttcaatcaatggcgg
caggctaccggactgcgtatctttgaaggctttgggcagtcggagacaaccgtttgctgc
tcgatcctgtacccatgggtgcagccgcgacccggttcgatggggatgcccacaccgggt
tatcagatggttgttgcggatgaagacggcaaagaggttgaccctggtgtaaccggggaa
atctgcatcaaagctccggattacgcgaccaagacgaaaggtcttttcatgggctattac
cgggacgaagtgaatacgcagcgttcctggcatgacggcctgtatcataccggcgatctg
gcctaccgtgatgagcttggtttcctgtggtatatcggcaggaatgacgacattattaaa
tcatccggttaccgcatcgggcctttcgaagtcgagtcggcgctcgcagagcatcccgct
gttctggaatcagcggtaacgggcgttccggatcctatcagaggatttaacgtcaaggcg
acgatcgtactgaacaaaggttacgaaccttcggaagacatgattaaggaattgcaggat
catgtcaaaaaggtaaccgcaccctataaatatccgagggtgattgagtttgtgaccgag
cttcccaaaaccatcagcggcaaaatccgcagggttgaaatcagggaaaaggactcacgg
tccgaataa

DBGET integrated database retrieval system