KEGG   Desulfovibrio sp. G11: CNY67_00560Help
Entry
CNY67_00560       CDS       T05183                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
def  Desulfovibrio sp. G11
Pathway
def00020  Citrate cycle (TCA cycle)
def00480  Glutathione metabolism
def01100  Metabolic pathways
def01110  Biosynthesis of secondary metabolites
def01120  Microbial metabolism in diverse environments
def01130  Biosynthesis of antibiotics
def01200  Carbon metabolism
def01210  2-Oxocarboxylic acid metabolism
def01230  Biosynthesis of amino acids
Module
def_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:def00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNY67_00560
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CNY67_00560
Enzymes [BR:def01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CNY67_00560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ATD80080
Position
complement(127354..128496)
Genome map
AA seq 380 aa AA seqDB search
MRKTVYWIEGDGIGPEIWQAARPVIEGAIRAAGADLTLDWVELLAGDKAVKENGHPLPEA
TLEALRHAELAMKGPLGTPVGTGIRSLNVALRQTLDLYACIRPVRHFEGLETPVKHPERV
NMVIFRENTEDVYAGVEFAANTPEARKLVAFLRDELGVTKVGDDAAVGIKPMTEAGSKRL
VRRALRFALDQKQESLTLVHKGNIMKFTEGAFRQWGYDVAAQEFGDCTCTEKEPVAGRLV
VKDRIADAMFQEALLRPEQYQVLATPNLNGDYISDALAAQVGGLGLAPGVNMSDTLAFYE
ATHGTAPTIAGKDKANPGSVILCGALMLEHLGQHDAAGRIRRAVAKAIAGKAVTEDLAAQ
VTGSRVVGCKEFGDIIGTNL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagactgtgtactggatcgaaggcgatggcattggcccggaaatctggcaggcc
gcccgcccggtcattgaaggggccattcgcgccgccggggctgaccttacccttgactgg
gtagaactgctggctggcgacaaggccgtgaaagaaaacggtcaccccctgcccgaagcc
acgcttgaagccctgcgccatgccgaactcgccatgaagggtcccctgggtacgcccgtg
ggcacgggcatccgcagtcttaacgtggccctgcgccagaccctggacctttacgcctgc
atccgccccgtgcgccactttgaagggctggaaaccccggtcaagcatcccgagcgcgtc
aacatggttatctttcgtgaaaataccgaagacgtgtacgcgggtgtggaatttgccgcc
aacacccccgaggcgcgcaaacttgtggcctttctgcgcgatgagctgggcgtgaccaag
gtcggcgacgacgctgccgtgggcatcaaacccatgacggaagcaggctccaagcgcctt
gtgcgccgcgccctgcgctttgccctggaccagaagcaggaaagcctcacccttgtgcac
aagggcaacatcatgaaattcaccgaaggcgcttttcgccagtggggctatgacgtggcc
gcccaggaattcggcgactgcacctgcaccgaaaaagaacccgtggccgggcgccttgtg
gtcaaagaccgcatagccgacgccatgttccaggaggcgctgttgcgccccgagcagtat
caggtgctggcaacgcctaacctcaacggcgactatatctccgatgcgctggcggcccag
gtgggcggcctcggccttgcaccgggcgtgaacatgtccgacacgctggccttctacgaa
gccacccacggcactgcccccaccatcgcgggcaaggacaaggccaatcccggtagcgtt
atcctgtgcggcgcgctcatgcttgagcacctgggccagcacgatgccgccgggcgcatc
cgcagggccgtggccaaggccattgcgggcaaggccgttaccgaagacctggccgcccag
gttaccggatcccgcgtggtgggctgcaaggagtttggcgacatcatcgggaccaacctg
tag

DBGET integrated database retrieval system