KEGG   Dehalococcoides mccartyi GT: DehalGT_0633Help
Entry
DehalGT_0633      CDS       T01182                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
deg00010  Glycolysis / Gluconeogenesis
deg00051  Fructose and mannose metabolism
deg00562  Inositol phosphate metabolism
deg01100  Metabolic pathways
deg01110  Biosynthesis of secondary metabolites
deg01120  Microbial metabolism in diverse environments
deg01130  Biosynthesis of antibiotics
deg01200  Carbon metabolism
deg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehalGT_0633
   00051 Fructose and mannose metabolism
    DehalGT_0633
   00562 Inositol phosphate metabolism
    DehalGT_0633
Enzymes [BR:deg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DehalGT_0633
Exosome [BR:deg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DehalGT_0633
  Exosomal proteins of bladder cancer cells
   DehalGT_0633
  Exosomal proteins of melanoma cells
   DehalGT_0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADC74000
Position
complement(599843..600604)
Genome map
AA seq 253 aa AA seqDB search
MRQIIIAGNWKMNTTLSEACTLVQSMKCELERIEGIEKIICPPFISLYPIKTILENSSIK
LGAQNLFYQEKGAYTGEISPLMLKELCQYVIIGHSERRAYFGETGQVVNQKIKAALQAGL
LPIVCVGEKPEENENGQTRQVLETQLKEALDGLNLSCIIIAYEPIWAIGTGKAATASEAN
SAIGYIRRVLGDTLGNAAAQTSPILYGGSVNEKNITEILSQTNIDGALVGGASLKAESFV
SICRQAAVIQNKH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagattattattgccggaaactggaaaatgaataccactctttccgaagcttgt
acacttgttcagagcatgaaatgcgaacttgagcggatagaaggcattgagaaaataatc
tgcccgccctttatatcgctgtatcccataaaaaccatactggaaaatagcagcatcaaa
ctgggtgctcaaaaccttttctaccaggaaaaaggggcttatacaggtgaaatatcccct
ctgatgctgaaagaactctgccaatacgttattataggccactctgaaagacgggcatat
ttcggtgaaacaggacaggtggtcaatcaaaagataaaggccgctcttcaggcaggccta
ctcccgatagtatgcgtgggcgaaaagcctgaagagaatgaaaacggccaaacccgccaa
gtgctggaaacccagctaaaagaggctctggacgggcttaacctcagctgtatcataata
gcctacgaacccatctgggcaatcggcaccggcaaggccgctaccgcttcagaagccaac
tctgccattggttatatccgccgggtgcttggtgatactctgggcaatgccgcagcccaa
acttctcctatactatatggcggcagtgtaaatgaaaaaaatattaccgaaattctttct
cagacgaatattgacggggctttggtgggtggcgcttctctaaaggctgaatcttttgta
agcatttgccgccaagccgccgttattcaaaataagcactaa

DBGET integrated database retrieval system