KEGG   Dehalococcoides mccartyi GT: DehalGT_0946Help
Entry
DehalGT_0946      CDS       T01182                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
deg00260  Glycine, serine and threonine metabolism
deg00750  Vitamin B6 metabolism
deg01100  Metabolic pathways
deg01110  Biosynthesis of secondary metabolites
deg01120  Microbial metabolism in diverse environments
deg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DehalGT_0946
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DehalGT_0946
Enzymes [BR:deg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DehalGT_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADC74307
Position
complement(906836..907882)
Genome map
AA seq 348 aa AA seqDB search
MKQGVIEHYRKYLPVTDKTPSLTLGEGDTPLVRCPKLEKELGVGELYFKLEGCNPTGSFK
DRGMVMAVAKVIEDGFKAVVCASTGNTSASATAYAAASGLESIIIIPSGKIALGKLAQAI
VYGAKIIQIKGNFDQALQIVFKLTEKHKVALVNSVNPYRIEGQKTAAFEIVDALGKAPDY
LFIPVGNAGNITAYWKGFKEYHQLGKAASLPKMMGFQAEGAAPIVRGHAIAEPETLATAI
RIGNPASWKKAEEARDESVGLIDMVSDAEIMAAYHKMASAGIFGEPASAAPLAGLIKRIK
GGQDFSASQIVCVVTGNGLKDSDIAIKGAGGFSETEASLGAVEKVLGW
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagggtgtcattgaacattaccggaaatatctgccggttacagataaaaccccg
tcacttactctgggtgagggcgataccccgttggtacgttgcccaaaactggaaaaagaa
ctgggggtaggtgagctgtatttcaagctggagggctgcaatcctactggttctttcaaa
gacaggggtatggtaatggcggttgccaaggttattgaagatgggtttaaagcggttgtg
tgtgcttccaccggcaataccagtgcttcggctaccgcatatgcggccgcaagcggtctt
gagtctataataatcataccgtccggcaaaatagcccttggcaaactggctcaggctatt
gtttatggggcaaaaatcatccagataaaaggcaactttgaccaagccctgcagatagtc
ttcaaacttactgaaaagcacaaggtggctctggttaactcggttaatccataccgtata
gaaggccagaaaaccgccgcttttgagattgtagacgctttgggcaaagcacctgactat
ctctttataccggtgggcaacgccggcaatattacggcctactggaagggttttaaagaa
taccaccagttgggcaaagcagcttcacttcccaaaatgatgggctttcaggctgaaggg
gctgctcccattgtacgcggtcacgccattgccgagcctgaaacactggctactgctatc
cgcatcggcaaccctgcttcttggaaaaaggccgaagaagccagagatgaatcagtcggg
ctgatagatatggtttcagatgccgaaataatggccgcttatcataaaatggcttctgcc
ggtatttttggcgaacctgcttccgccgcacccttggccgggctgataaaacggataaag
ggcggtcaggatttttccgcaagccagatagtctgtgtagttaccggaaacggcctgaag
gacagtgatattgctataaaaggggcgggaggtttttccgaaaccgaagccagccttggg
gcagtggaaaaagtactgggctggtag

DBGET integrated database retrieval system