KEGG   Dehalococcoides mccartyi CBDB1: cbdbA181Help
Entry
cbdbA181          CDS       T00273                                 

Gene name
gly1
Definition
(GenBank) putative threonine aldolase (COG2008)
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
deh00260  Glycine, serine and threonine metabolism
deh01100  Metabolic pathways
deh01110  Biosynthesis of secondary metabolites
deh01120  Microbial metabolism in diverse environments
deh01130  Biosynthesis of antibiotics
deh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cbdbA181 (gly1)
Enzymes [BR:deh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     cbdbA181 (gly1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CAI82429
Position
163704..164738
Genome map
AA seq 344 aa AA seqDB search
MKIIDLRSDTVTRPTPEMKKAMCDAPLGDDVFGEDPTVNRLEEMAAGKTGKEAALFTPSG
IMSNLLSVLSQTRPGDEIILGSEAHILWYEVGGASAVGGVVMRAVPNQPDGTIHLADIKD
AIRGSNLHFPPTRLICLENTHNRCGGAVLSPSYTAGVANLARMRGIKVHLDGARLFNACV
ALGVSAKELCQGMDTVSFCLSKGLSAPAGSLLCSDQETINRARKFRKMLGGGMRQAGVLA
ACGIVALETMIERLALDHAMAKTLAESLFDIDNHTLDKQIVQTNIVIFNPPFGLGADEFL
EQAKQAGLLFTKGSHGRVRAVCHHDLSEADIQTAIKRIAAMKKA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatagaccttcggagtgatactgttacccgtcccacccccgaaatgaaaaaa
gccatgtgcgatgcccctctgggagatgacgtgtttggggaagatcccactgtaaaccgt
ctggaggaaatggcagccgggaaaacgggtaaagaggccgctttgtttacccccagcggc
atcatgagtaatctgctttcagtcctgtcccagacccgcccgggtgatgaaataatactg
gggagtgaagcccatatactctggtacgaagtaggcggggcatcagcagtgggaggtgtg
gttatgcgggctgtgccaaaccaacctgacggcactatccatctggcagatataaaagat
gctatacgcggctcaaatcttcattttccgcctacccggcttatctgtctggaaaatacc
cacaaccgttgcgggggtgcggtgctaagcccgtcctacaccgccggggtggcaaatctg
gccagaatgcggggtattaaggtccatctggacggtgcccgtttgttcaatgcctgtgtg
gctctgggtgtttcagccaaggaactctgtcaggggatggatacagtcagtttttgcctt
tcaaaagggctgtcggcaccggcaggatcacttttgtgttctgaccaagaaaccataaac
cgggccagaaaattccgcaagatgctgggcggaggcatgcgtcaggccggggtattagca
gcctgcggtattgtggcgctggaaactatgatagagcgcttggctctggatcacgctatg
gctaaaactctggcggaaagtctgtttgatatagataaccatacgctggataaacaaatt
gtccaaaccaatattgtcattttcaacccgccgtttggtcttggtgctgacgaattttta
gagcaggccaagcaggccgggttactctttaccaagggtagtcacggccgggtcagggct
gtttgccaccatgacctgagcgaggcagatatacaaacggccattaagcgtattgcagct
atgaaaaaggcttag

DBGET integrated database retrieval system