KEGG   Dehalococcoides mccartyi CBDB1: cbdbA41Help
Entry
cbdbA41           CDS       T00273                                 

Definition
(GenBank) putative phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
deh  Dehalococcoides mccartyi CBDB1
Brite
KEGG Orthology (KO) [BR:deh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    cbdbA41
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: CAI82312
Position
30511..31512
Genome map
AA seq 333 aa AA seqDB search
MPDASFLPYLLIILLAIGFAFVNGTNDTANAIATVVGTRVLSPRKAIIMAAVANLVGVFT
GTAVARTIGKGILGPESLTYETVIAGLIAAVIWSVVATRKGLPVSLTHCLVAGLAMAGVA
MAGFGSVDWGILLKIIAAVGIAPIMGMAGGYLLMVALLWIFRRSVPSKTNGLFSHLQIFS
AAFMAFSHGRSDGQMPMGIIALGTVLYTGNAGLWDAIPLWIIVLSALSISAGTAIGGWRV
IQTVGVRMTNLRPINGFAAETAAATVIQIAASIGIPVSSTHAISSAIMGVGATRRLSAVR
WGVAGNIVGAWLLTFPICGALGFLVAGLFKLIF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgcctcgtttttaccttatcttcttattatccttttagccataggttttgcc
tttgtaaacggtaccaacgacacagctaatgccattgccaccgtggttggtacgcgtgtt
ttgtctccccgcaaggctataataatggcggcggttgccaatcttgtgggtgtttttacc
ggtacggctgtggccaggactattggcaagggcatactgggacctgaatcacttacctat
gaaacagttattgcaggacttatagctgcagttatctggtctgtggtggctacccgtaag
gggcttcccgtaagtctgacgcactgtctggtggccggtctggccatggccggtgtggct
atggcggggtttggatcggtagattggggtattcttttaaagattattgcggctgtaggt
attgcccctattatgggtatggcaggtggttacctgcttatggttgccttgctttggata
ttcagacggagtgttccctccaagactaatgggcttttttcccaccttcaaatattttca
gccgctttcatggctttcagccacgggcggagtgacgggcagatgcctatgggtattatt
gctctgggtacagtgctttataccggtaatgccggtctctgggacgctataccgctttgg
attattgttctttcggctttgtctatcagcgcagggacggctatcggcggttggagggtt
atccagacagtgggcgtgcgtatgactaaccttaggccgataaatggttttgcggctgaa
actgctgccgctacagttatccagatagcggcttcaataggtattcctgtgtcaagcacc
catgccatttcttcggctattatgggggtgggagctacccgcaggctttctgcagtacgc
tggggtgtggcgggaaatattgtgggggcgtggctgctcacctttcctatatgcggtgcg
ctgggttttttggtggctggtttgtttaaacttattttctaa

DBGET integrated database retrieval system