KEGG   Dehalococcoides mccartyi CBDB1: cbdbA469Help
Entry
cbdbA469          CDS       T00273                                 

Gene name
rplM
Definition
(GenBank) ribosomal protein L13
  KO
K02871  large subunit ribosomal protein L13
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
deh03010  Ribosome
Module
deh_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:deh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    cbdbA469 (rplM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:deh03011]
    cbdbA469 (rplM)
Ribosome [BR:deh03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    cbdbA469 (rplM)
  Bacteria
    cbdbA469 (rplM)
  Archaea
    cbdbA469 (rplM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L13 DUF3659
Motif
Other DBs
NCBI-ProteinID: CAI82670
UniProt: Q3ZZP3
Position
381798..382229
Genome map
AA seq 143 aa AA seqDB search
MNTYTVKANDIKRDWHVIDASGRVLGEVAAEAAKYLMGKHKPMFCRNLDCGDYVVIVNAK
KITVTGNKLDQKMYYRHSGFPGGFRQEKLGDLLKTKPLFVIEHAVKGMIPRNTLGAQILA
KLKVYEGAEHPHASQTGVVSKES
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttacacagttaaagctaatgacataaaacgggattggcacgtaatagatgcc
tccggccgtgtgctgggtgaggtagctgctgaagcggccaaatacctcatgggcaagcac
aaacccatgttctgccgcaatctggattgcggtgactacgtggttatcgtaaatgcaaag
aagataacggttaccggcaacaagctggaccagaagatgtattatcgccattccggcttc
cccggcggtttccgccaggaaaaactgggtgaccttctgaaaaccaagcctttgtttgtg
attgaacatgctgtaaagggcatgattccccgcaataccttgggtgcccagattttggct
aaattaaaggtctatgaaggtgcggaacacccccatgcctctcagaccggcgtagtaagc
aaggagtcttaa

DBGET integrated database retrieval system