KEGG   Dehalococcoides mccartyi CBDB1: cbdbA988Help
Entry
cbdbA988          CDS       T00273                                 

Definition
(GenBank) acyl-CoA synthetase (AMP-forming) / AMP-acid ligase
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
deh00360  Phenylalanine metabolism
deh01100  Metabolic pathways
deh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:deh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    cbdbA988
Enzymes [BR:deh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     cbdbA988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C_2 AMP-binding GH3
Motif
Other DBs
NCBI-ProteinID: CAI83105
Position
complement(796559..797878)
Genome map
AA seq 439 aa AA seqDB search
MVIRNPEYETLPRPQLEELQLKRLQETVSYVYNRNPFYHQSMDKLGIKPADIKMLKDLAL
LPFTSKEDFRQNYPFGLCCVPKTEISRIQSSSGTTGKPVIAPYTAKDVDTWAELVARSLS
CAGVVPEDILQNAYGYGLFTGGLGIHYGAEKMGVAVVPASTGNTKRQLMLLQDLGTTVIT
CTPSYSLIMYEAGKEMGLDFHNSSLKLGIMGAEPWSENMRREIEAKLGITALNIYGLTEI
TGPGVAMECPQKCGLHIWEDNFMVEIINPETGEVLPYGQKGELVITTINKQAQPVLRFRT
KDITSLMPEKCGCGRTMVRMSQITGRSDDMIRVRGVSVFPSQIESVLLTVEGIEPHYQII
VDRHNAFASDELEIWVEVSEGIFSDEMSRLNALQKKLQSELDSVLGIRAKIKLVEPRTLA
RTEGKAKRIIDRSELPENR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtggttatacgtaaccccgaatatgaaacccttcccagaccgcagcttgaagagttacag
ctgaaaagacttcaggaaacagtgtcctatgtctataatagaaatccattttaccatcaa
agcatggataaactagggatcaaacccgcagatataaaaatgttgaaagacctcgccctg
cttcctttcaccagtaaagaagatttccgccagaattaccctttcgggttatgctgtgtg
cctaaaacagaaatatcacgtatccagtcttcctccggtactaccggtaaacctgtaatt
gccccctatactgccaaagatgtggatacatgggcggaactggtagcccgttctctaagc
tgtgccggggtagtgcccgaagatattctccagaatgcctacggatacgggctttttacc
ggcgggctggggattcattacggggcggagaaaatgggggtggcggtagtgccagcctct
accggcaatactaaacgtcagttgatgttgctgcaggatttggggactaccgtgattacc
tgtactccgtcttactctctgataatgtatgaagccggcaaggaaatggggcttgatttt
cataattcttcactcaagctgggcattatgggtgctgaaccatggagtgaaaatatgcga
cgggagatagaagccaaactgggtatcactgcccttaatatatatggcttgactgaaata
accgggccgggtgtagctatggaatgtccccagaaatgcgggttgcacatctgggaagat
aatttcatggtggaaataataaaccctgaaacaggcgaagtgcttccttacggccaaaaa
ggagaactggtaattaccaccataaacaaacaggctcagccggtactccgtttccggacc
aaagacattaccagcctgatgcctgaaaaatgcggctgcgggagaaccatggtacgtatg
tctcaaattaccggccgcagtgatgacatgatacgggttagaggtgtttcagtgttcccc
tcgcagattgaaagcgtacttctcaccgtagaaggcattgaaccccattaccagataata
gtagacaggcacaatgcttttgcctctgacgaactggaaatatgggtagaggtttccgaa
ggcattttctcggatgaaatgtcacggttgaatgcccttcagaagaagcttcagtccgaa
ctggatagcgtattgggtatacgtgccaaaatcaagctggttgaaccgcgtactctggcc
agaactgaaggcaaggcaaaaaggattattgaccgttccgaattacctgaaaacaggtag

DBGET integrated database retrieval system