KEGG   Devosia sp. I507: C4375_03030Help
Entry
C4375_03030       CDS       T05346                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
dei  Devosia sp. I507
Pathway
dei00860  Porphyrin and chlorophyll metabolism
dei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dei00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C4375_03030
Enzymes [BR:dei01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     C4375_03030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA MobB DUF1611
Motif
Other DBs
NCBI-ProteinID: AVF02809
UniProt: A0A2L1S302
Position
complement(659036..660493)
Genome map
AA seq 485 aa AA seqDB search
MTNAIMFMGTGSDVGKSLIVAGLCRALNNRGLKVAPFKPQNMSNNAAVTADGGEIGRAQA
LQARAARRDSVTAMNPVLLKPEGETGSQVVVRGQRRASLSARQYWADRGQLLPDVLAAFS
ELARDADIVLVEGAGSASEVNLRDGDIANFGFARAANVPVVLIGDIHRGGVIASIVGTLA
VIEPGDAALVRASLINKFFGDPALFATGRTFLAERTGRPCFGPVPHFADAARLPAEDALA
LESYAGGNGAFHIAVPRLPRIANFDDLDPLRAESGVTLTLVQPGHALPRDADLILLPGSK
ATRADLVALRANGWDIDILAHHRAGGHVMGICGGYQMLGRTIADPDGVEGAPGTSDGLGL
LAVDTVLAPTKQLRTERAIHLASGEALAGYHMHMGITSGPDRARPFAQIGSETDGAVSTD
GRVSGTYLHGLFAADSFRRAILGASAGPDLNYEAGVEDALDGLAHHLETHIDIDQLLALA
APIET
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgccatcatgttcatgggcacaggctcggatgtcggaaagtccctcatcgtg
gcgggcctttgccgcgcgctcaacaatcgtggcctcaaggtcgcgcccttcaagccgcag
aacatgagcaataatgccgccgtgaccgcggacggtggcgaaatcgggcgcgcccaggcc
ctgcaggcccgcgcagcccgtcgcgattccgtcaccgcgatgaacccggtgctgctaaag
cccgagggtgaaacaggctcgcaggttgtcgtgcgcggtcagcgccgcgccagcctttca
gcgcgacaatactgggccgatcgcgggcaattgctgcccgatgttctggccgccttctct
gagctggccagagacgcggacatcgtgctggtcgagggcgccggcagcgcctccgaggtc
aatctgcgcgacggcgacattgccaatttcggctttgcccgcgctgcaaatgttccggtt
gtgctgatcggcgacatccatcgcggcggggttatcgcctccattgtgggcactctggcc
gtcatcgaacccggcgacgccgcactggtgcgggccagcctcatcaacaagttcttcggc
gacccggccctgttcgcaacgggacgcacgtttctggccgagcgcaccggccggccatgt
ttcggccccgtgccgcatttcgcggatgcagcaaggctgcctgcggaagacgccttggcg
ctcgaaagctatgccggcggcaatggcgctttccatattgccgtgccgcgcctgccacgc
atcgccaactttgacgatctcgaccccttgcgggccgaatccggggtgacgctgaccctg
gtgcaaccggggcatgcccttccgcgtgacgcagatctcatcctgctgccgggttccaag
gccacacgggccgacctcgtcgcgctgcgtgccaatggttgggacatcgatattctggcc
catcaccgggccggcgggcatgtgatgggcatttgcggcggctaccagatgctcggccga
accattgctgacccggacggcgtcgaaggcgcccccggcaccagcgatggcttgggcttg
cttgcggtcgataccgtgctcgccccgaccaagcaattgcgcaccgagcgggccatccat
ctggccagcggcgaagcgcttgccggctatcacatgcatatgggcatcacgagcggcccc
gacagggcacggcccttcgcccagatcggcagtgaaaccgatggtgccgtcagcaccgat
ggacgcgtatccggcacctatttgcacggcctgtttgccgccgatagcttccgccgcgct
atcctgggagcgtctgccggcccggacctcaattatgaagcaggcgtggaagatgcgctc
gatggtcttgcacaccaccttgaaacccatatcgatatcgaccagctcctcgccctggcc
gcaccgatagagacctga

DBGET integrated database retrieval system