KEGG   Devosia sp. I507: C4375_13805Help
Entry
C4375_13805       CDS       T05346                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dei  Devosia sp. I507
Pathway
dei00260  Glycine, serine and threonine metabolism
dei01100  Metabolic pathways
dei01110  Biosynthesis of secondary metabolites
dei01120  Microbial metabolism in diverse environments
dei01130  Biosynthesis of antibiotics
dei01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dei00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C4375_13805
Enzymes [BR:dei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C4375_13805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AVF04673
UniProt: A0A2L1S8B9
Position
2829736..2830755
Genome map
AA seq 339 aa AA seqDB search
MNAIRHDFRSDTVTRPSAGMRAAMAAAEVGDDVFGDDPTVNLLEQRMAGMLGKNAALFVP
SGTMSNLLALMSHCGRGDEFIAGQNAHCYKYEAGGAAVLGSIQPQPIAHQADGTMALGEI
EAAIKSGDNHFATTRVIALENTFGGRVLPVDYMTAVAEIAARHGLGLHLDGARAFNACVA
LDLDIKDFVAPFDTVSICLSKGLGTPVGSVLVGRQDLIETARRHRKMLGGGLRQSGILAA
AGLYALEHNVGRLAEDHRRAKALAEGLARHEALRVTMPDTNILWVDMAADLGERFTAYLG
EHGVGVTGRYGQQRWVTHLDVADEDVTQALALVDRFFAG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccattcgtcacgacttccgatccgacacggtcaccaggcccagtgccgggatg
cgagcggccatggccgccgccgaggtgggcgatgacgtgttcggcgacgatccgacagtc
aatctgctcgaacagcgcatggccgggatgctgggcaagaatgcggcactgttcgtgccc
tcggggacgatgtcgaacctgctggcgctgatgagccattgcggccggggcgatgaattc
atcgccgggcagaatgcgcattgctacaaatatgaggcgggcggggcggccgttctgggc
tcgatacagccgcagccgattgcgcatcaggccgatggcaccatggcgctgggcgagatc
gaggccgccatcaagagcggcgacaaccattttgccacgacgcgggtgattgcactggaa
aacacgtttggtggtcgcgtgctgccggtggactatatgacggccgtagcggaaatcgcg
gcgcggcatgggctgggcctgcatctggatggcgcgcgggcgttcaatgcgtgcgtggcg
ctcgatcttgatatcaaggatttcgtggcgccgttcgacacggtttcgatctgcctgtcg
aagggattgggcacgccggtcgggtcggtgctggtcgggcggcaggatctgatcgagaca
gcgcgacgccatcgcaagatgctgggcggcgggctgcggcagtcgggcatcctggcggca
gcggggctctatgccctggaacacaatgttggccggctggccgaggaccaccggcgggcc
aaagcgctggccgaggggctggcgcggcatgaggcactgcgggtcaccatgcccgacacc
aatatattgtgggtcgatatggcggccgatctgggcgagcgcttcaccgcctatctgggt
gagcatggcgtcggcgttacgggccgctatggccagcagcgctgggtgacacatcttgac
gttgctgatgaggatgtcacccaggcgctggcattggtggaccggtttttcgcaggctaa

DBGET integrated database retrieval system