KEGG   Devosia sp. I507: C4375_17025Help
Entry
C4375_17025       CDS       T05346                                 

Definition
(GenBank) AraC family transcriptional regulator
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
dei  Devosia sp. I507
Pathway
dei00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:dei00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    C4375_17025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dei01002]
    C4375_17025
Enzymes [BR:dei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     C4375_17025
Peptidases [BR:dei01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   C4375_17025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI GATase_3
Motif
Other DBs
NCBI-ProteinID: AVF05235
UniProt: A0A2L1S9Y1
Position
3469909..3470583
Genome map
AA seq 224 aa AA seqDB search
MTLNIGFLVFPNVQQLDLTGPYEVFASAADVAVHLLWKDLAPLRSATGLMLSPTMTLGDC
PQLDLICIPGGAGVNALLNDRQVLDFVRTQAAGAQFVTSVCTGSLVLGMAGLLEGRRATS
HWNAVDLLPRLGAIPTPGRVVRDGNVITAGGVTSGIDFGLTVLAELQGEVAARRVQLALE
YAPAPPFDSGTPEACDADLVATVRQGMARARSEREVLLPPVRPQ
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcaatatcggatttctcgtctttcccaatgtgcagcagctcgacctgaccggc
ccctatgaggtgttcgcctcggcggccgacgtagcggtgcatcttttgtggaaggacctg
gccccgctgcgcagcgccaccgggctaatgctgtcgccaaccatgacactcggggattgc
ccgcaactggatctgatctgcattcccggcggtgccggggtcaatgcgctgctcaacgac
cggcaagtcctcgatttcgtgcggacccaggcggccggggcgcaattcgtgacatcggtc
tgcaccggttcgctggtcctgggcatggcagggctgctggaaggccgccgggcgacgtcg
cactggaatgctgtggacctcttgccacgccttggcgccattccgactccgggccgggtg
gtacgcgacggcaatgtcatcacggcaggcggggtgacctcgggaattgatttcgggttg
acggtattggccgaattgcagggtgaagtggcggcgcgtcgggtgcaactggcgctcgaa
tatgcgccggcgccgccctttgacagcgggacgcccgaggcctgcgatgcggacctggtg
gcaacggtgcgccagggcatggcgcgcgcgcgttcggaaagggaggttttgctgccgccg
gtcaggccgcagtaa

DBGET integrated database retrieval system