KEGG   Pseudodesulfovibrio indicus: AWY79_03065Help
Entry
AWY79_03065       CDS       T04404                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
dej  Pseudodesulfovibrio indicus
Pathway
dej00471  D-Glutamine and D-glutamate metabolism
dej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dej00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AWY79_03065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dej01011]
    AWY79_03065
Enzymes [BR:dej01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     AWY79_03065
Peptidoglycan biosynthesis and degradation proteins [BR:dej01011]
 Precursor biosynthesis
  Racemase
   AWY79_03065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race FIST
Motif
Other DBs
NCBI-ProteinID: AMK10167
UniProt: A0A126QK48
Position
complement(655942..656781)
Genome map
AA seq 279 aa AA seqDB search
MKKEAKLPIGMFDSGVGGLTVLKALRERMPCEDVVYLGDTARLPYGTKSPQTVTRYGVQC
GAELIRRGIKLLVVACNTASAVALDALREAYPDVPVIGVVDPGARAACAASRNRAIAVIA
TESTIARGAYQRAIHAIDPQTRIIGHPCPLFVALAEEGWTDGQVPEAVAARYLDPVFKPA
SGTGHPDVPDTLVLGCTHFPLLAPAIRNVVPAGTTIVDSAATTAETVHQQLQELQLARPE
NGCGATRYLTTDDAARFARTGSRFLGTPIAEHDVELVDL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaagcgaagctgcccatcggcatgttcgattcgggcgtgggcgggctgacc
gtgctcaaggcgttgcgcgagcgcatgccctgcgaagacgtggtctatctcggcgatacc
gcgcggctgccctacggcaccaagtcgccccagaccgtcacccggtacggggtgcagtgc
ggcgcggagctcatccgccggggcatcaagctgctcgtggttgcctgcaacaccgcctcg
gccgtggccctcgacgccctgcgcgaggcctaccccgacgtgccggtcatcggcgtggtc
gaccccggcgcgcgcgccgcctgcgccgcctcccgcaaccgcgccatcgccgtcatcgcc
accgaatcgaccatcgcgcgcggggcctaccagcgcgccatccacgccatcgatccccaa
acgcgcatcatcggccacccctgcccgctcttcgtggccctggccgaggaaggctggacc
gacggacaggtgcccgaagccgtggccgcccgctacctcgacccggtcttcaaacccgca
tccggcaccggacaccccgacgtgcccgacaccctcgtcctcggctgcacccacttcccg
ctgctcgcacccgccatccgcaacgtggtgcccgccgggaccaccatcgtggactccgcc
gccaccaccgcggaaaccgtccatcaacaactccaggaactccaactcgcccggcccgaa
aacggctgcggcgccacccgctacctgaccaccgacgacgccgcacgcttcgcccgcacc
ggctcccgcttcctcggcactcccatcgccgagcacgacgtggaactcgtcgacctgtag

DBGET integrated database retrieval system