KEGG   Pseudodesulfovibrio indicus: AWY79_09445Help
Entry
AWY79_09445       CDS       T04404                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dej  Pseudodesulfovibrio indicus
Pathway
dej00450  Selenocompound metabolism
dej00970  Aminoacyl-tRNA biosynthesis
dej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dej00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AWY79_09445
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AWY79_09445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dej01007]
    AWY79_09445
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dej03016]
    AWY79_09445
Enzymes [BR:dej01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AWY79_09445
Amino acid related enzymes [BR:dej01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AWY79_09445
Transfer RNA biogenesis [BR:dej03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AWY79_09445
 Prokaryotic type
   Other AARSs
    AWY79_09445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: AMK11322
UniProt: A0A126QMY2
Position
2138533..2140473
Genome map
AA seq 646 aa AA seqDB search
MQRFYITTPIYYVNAKPHLGHAYTTTVADSLNRFHRLMGEETYFLTGTDEHGDKIVQAAE
SNGQTPQEYVDVISKLFKDLWPGMNISNNDFIRTTEPRHKEVVQQILQKVYDSGDIYFGE
YGGHYCFGCERFYTEKELVNGMCPDHQTKPEYIAEKNYFFKMSKYRDWLLEHIRKNPDFI
RPERYRNEVVSLLESGELEDLCISRPKTRLTWGIELPFDADYVTYVWFDALINYVAALGY
PEGDKFKKFWPVANHLVAKDILKPHAIFWPTMLKAAGIEPYQHLNVHGYWLVEDTKMSKS
LGNVIEPLAMKDAYGLDAFRYFLLREMSFGQDSSFSEKALVGRLNADLANDLGNLFNRTL
SMTHKYFGGAIPRPEVEDVVDAEIKKLGQAAMQSFQDFFSDLKFSRALEGLWELVRGLNK
YIDETAPWALFKEKNTGRLSTVIYVLLENMRKIAVHLWPVMPEASEKMLEQLGITFAPEK
INLPKEMDVWGLLESDTVVAETSNLFPRVDLPAEAEPEKPAKAKKAKKEAKAEAVEEIPE
IDFDDFQKLDLRVGTVQSVEKHPDADRLLLVQVDTGEKDLRQVVAGLADYFQPDDLVGRQ
VVVVANLKPRKLRKQLSRGMILAVKTENGMELLTPSGQVAPGSKVS
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacgtttttacatcaccacgcccatctactacgtgaacgccaaaccccacctggga
cacgcgtacaccaccaccgtggccgacagcctgaatcgcttccaccggctgatgggtgag
gagacctactttctgaccggcacggacgaacacggagacaagatcgtccaggcggcggag
agcaacggccagaccccgcaggagtatgttgacgtcatcagcaagctcttcaaggacctt
tggccgggaatgaacatttccaacaacgacttcatccgcaccaccgagccgcggcacaag
gaagtggtccagcagattctgcagaaggtctacgattcaggagacatttacttcggcgaa
tacggcggacactactgcttcggctgcgaacggttctacaccgagaaggaactggtcaac
ggcatgtgcccggatcaccagaccaagccggaatacatcgccgagaagaactacttcttc
aagatgtccaagtaccgcgactggctgctggaacacatccgcaagaaccccgatttcatc
cgccccgagcggtacaggaacgaggtcgtctccctgctggagtccggcgaactcgaagac
ctctgcatctcccggcccaagacccggctgacctggggcatcgagctgccgttcgacgcc
gactacgtgacctacgtctggttcgacgcgctcatcaactatgtggccgccctgggctac
cccgaaggcgacaagttcaagaaattctggcccgtggccaaccacctggtggccaaggac
attctcaagccccacgccatcttctggccgaccatgctcaaggcggccggcatcgagccg
taccagcacctcaacgtgcacggctactggctggtggaggacaccaagatgtccaagtcc
ctgggcaacgtcatcgagccgctggccatgaaggacgcctacgggctggacgccttccgc
tatttcctgctgcgcgagatgtccttcggccaggattccagcttctccgaaaaggcgctg
gtcggccgcctcaacgcggacctcgccaatgacctcggcaacctgttcaaccgcactctg
tccatgacccacaagtacttcgggggggccatcccccggcccgaagtggaggacgtggtg
gacgccgagatcaagaagctggggcaggccgccatgcagtccttccaggacttcttctcc
gacctcaagttctcccgcgccctcgaaggactgtgggagctggtccggggcctgaacaaa
tacatcgacgagaccgcgccgtgggccctgttcaaggaaaagaacaccggccggttgtcc
acggtcatctacgtgctcctcgaaaacatgcgcaagatcgccgtccatctgtggccggtc
atgcccgaggcgtccgaaaaaatgctcgaacagctcggcatcaccttcgccccggaaaag
atcaacctgcccaaggaaatggacgtctggggactgctggagtccgacaccgtcgtggcc
gagacctccaacctcttcccgcgcgtggacctgcccgccgaggccgagccggaaaagccc
gccaaggccaagaaggccaaaaaggaagccaaggccgaagccgtcgaggaaatccccgag
atcgacttcgacgatttccagaaactcgacctgcgcgtgggcaccgtccagtccgtggaa
aaacacccggacgccgaccggctgctgctcgtccaggtggataccggcgaaaaggacctg
cgccaggtggtggcgggcctcgccgactacttccagcccgacgacctcgtcggcagacag
gtggtcgtggtcgccaacctcaagccgcgcaaactccgcaaacaactctcccgaggcatg
atcctcgccgtcaaaaccgaaaacggcatggaactcctgaccccgtccggccaagtcgcc
cccggcagcaaagtcagctag

DBGET integrated database retrieval system