KEGG   Pseudodesulfovibrio indicus: AWY79_09555Help
Entry
AWY79_09555       CDS       T04404                                 

Definition
(GenBank) hypothetical protein
Organism
dej  Pseudodesulfovibrio indicus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AMK11342
UniProt: A0A126QN01
Position
2165089..2166036
Genome map
AA seq 315 aa AA seqDB search
MTDYNTYDEGMAQLYAPKEAAMPRTGDISTNGAGMTCDESGRVVIHHDPTTYDVWDEQQR
ARSNGAHYLDTARTASGTPLMGRDGLTDESIVTLRDGTEARVKDLVTAGILTKNPDGTFS
EAPSPKTAQDKPRQAQEAREELLDEGNEKTLHALGHMVDQSTIYGALNRLAAGDDIDSYI
GRAASQVGKEPGEMAEIVGSLRSHFEAQAHRAVASMGLDPDQCFDWVRENRPRELHKAIM
DHATRRTTAGYKALAGEFMADLDKVNPDAILNADLGEGILEARQVGNEIVLKTASQGEIT
WKTAVKMGLVKVGRK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactacaacacctacgacgaaggcatggcccagctttacgcccccaaggaagcc
gccatgcccaggaccggcgacatcagcaccaacggcgcagggatgacgtgtgacgagtct
ggccgtgtcgtcatccatcatgaccccacgacctacgatgtatgggatgaacagcagagg
gccaggagcaacggggcgcactacctggacactgcccgtaccgcttccggcacccctctc
atgggccgagacggtctgacggatgaatccatcgttactctccgtgatgggaccgaagcc
agggtcaaggacctcgttaccgctggcatcctgacgaagaaccctgacggcacgttctcc
gaggcaccttcccccaagaccgcccaggataagccgagacaggcccaggaagcccgagag
gagcttctggacgaaggaaacgagaagacccttcacgcactggggcacatggtcgatcag
tccaccatctacggcgcgttgaatcgtctcgccgcaggggatgacatcgacagctacatc
ggtcgtgccgcttcccaggtgggcaaagagccgggggagatggccgagatcgtgggcagt
ctccgctcccattttgaagcacaggctcatagggccgtagcttcgatgggcctggaccct
gaccagtgcttcgattgggtacgcgagaacaggccgagggagcttcacaaggccatcatg
gaccatgccacccgcaggaccaccgccggatacaaggccctcgccggggagttcatggca
gacctcgacaaggtgaaccctgacgcgatcctcaacgccgaccttggggaaggcatcctg
gaggctcgacaggtgggcaatgagattgtcctcaagacggcctctcagggtgagatcacc
tggaagacggcggtcaagatggggcttgtcaaggttggccggaagtag

DBGET integrated database retrieval system