KEGG   Pseudodesulfovibrio indicus: AWY79_09675Help
Entry
AWY79_09675       CDS       T04404                                 

Definition
(GenBank) sulfurtransferase
Organism
dej  Pseudodesulfovibrio indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese Rubrerythrin Ferritin_2
Motif
Other DBs
NCBI-ProteinID: AMK11365
UniProt: A0A126QPI7
Position
2194681..2195505
Genome map
AA seq 274 aa AA seqDB search
MSTISQMTPDQARRFMEAGKPDAYTLLDVRQDWEYEEDHLPGALHIPLPELPDRIQELDP
EGTLLVYCASGGRSMAAAALLEGQGFEDINNLVGGMSAWEGHSAFGPMELGLVAYTGAES
PAEVLLKAYAMEDALQIFYVERADMAETMERIQLFMELAGFEDKHKDTLYELYTRVVDEP
MSRDEFEETALRNLAEEVEGGVPIGEFLDQFPGAFDDDQGVLQLASMVEAQALDYYLRCV
RRSKVEETRKVLQILAREEKAHLKVLGKHMDRRE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccatatcgcagatgacgcccgatcaggcccgcagattcatggaagcaggcaag
cccgatgcctacacccttctcgatgtccgccaggactgggaatacgaggaggaccatctc
cccggagcgctgcacatccccctgccggagctcccggaccgcattcaggagttggacccc
gaggggacgttgctcgtctattgcgcctccggcgggcggagcatggccgccgccgcgttg
ttggaagggcagggcttcgaggacatcaacaacctcgtgggcggtatgtccgcctgggaa
ggccattccgccttcggccccatggagctggggctggtcgcctacacaggggcggaaagc
ccggccgaggtgctgctcaaggcctacgccatggaggacgccctccagatattttacgtg
gagcgcgcggacatggccgagaccatggagcgcatccagctgttcatggagctggccggg
ttcgaggacaagcacaaggacaccctgtacgagctgtacacccgtgtggtcgacgagccc
atgagccgggacgagttcgaggagaccgccctgcgcaacctggccgaggaggtcgagggc
ggggtacccatcggcgaatttctggatcagtttccgggggccttcgacgacgaccagggc
gtgctccagctcgcctccatggtcgaggcccaggccctggactactacctgcgttgtgtg
cggcggtccaaggtggaggagacccgaaaggtcctccagatactggcccgcgaggagaag
gcccacctcaaggtgctcggcaagcacatggaccggcgggaatga

DBGET integrated database retrieval system