KEGG   Pseudodesulfovibrio indicus: AWY79_09860Help
Entry
AWY79_09860       CDS       T04404                                 

Definition
(GenBank) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
dej  Pseudodesulfovibrio indicus
Pathway
dej00220  Arginine biosynthesis
dej00250  Alanine, aspartate and glutamate metabolism
dej01100  Metabolic pathways
dej01110  Biosynthesis of secondary metabolites
dej01130  Biosynthesis of antibiotics
dej01230  Biosynthesis of amino acids
Module
dej_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:dej00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AWY79_09860
   00220 Arginine biosynthesis
    AWY79_09860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dej04147]
    AWY79_09860
Enzymes [BR:dej01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     AWY79_09860
Exosome [BR:dej04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AWY79_09860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-ProteinID: AMK11398
UniProt: A0A126QNY4
Position
2232047..2233432
Genome map
AA seq 461 aa AA seqDB search
MAEKKMWGGRFAEGTAASMEAYSESVSFDRLLYAEDIRGSQAHARMLAKQGFLTDDEAKI
ICDGLDKVRAEIESGEFVWKTEMEDVHMNVESRLTEIIGPLGGKLHTARSRNDQVALDFR
LFVAARLAVWKELLASLVRTYVDRAEEHRETMLPGCTHFQPAQPVSLAHHLLAYCQMFKR
DHERVADALKRVRVMPLGAAALAGTTHPVAPAVVAEDLGFEAVFANSMDAVSDRDFVLEA
VFDGSLIMAHLSRMCEELIIWANPNFGYVKLPDQYSTGSSIMPQKKNPDACEIMRGKTGR
VVGDLMGLLVLIKGLPMTYNRDMQEDKEPFFDADRTVSASLGIMADMLRLMVFVPEKMAA
TVKRGFLNATELADYLAAKGVPFREAHHITGAAVAYAEKKGVGLEDLELTELQEFSGEIG
EDVYAVLDYQAAIERRATPGGTGPKSVAAQIGALKEWLGSL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagaagatgtggggcgggcggttcgccgaaggaacggccgcgtccatggag
gcgtattccgagtcggtctcctttgaccggctgctgtacgccgaggacattcgcggctcc
caggcccacgcccgcatgctggcgaagcagggcttcctgacggacgacgaggcaaagatc
atctgcgacggcctggacaaggtccgggctgagatcgagtccggcgagttcgtctggaag
accgagatggaagacgtgcacatgaacgtcgagtcccggctgaccgagatcatcggcccc
ctgggcggcaagctgcacaccgcgcgcagccgcaacgaccaggtggccctggacttccgg
ttgttcgtcgccgcgcgccttgccgtgtggaaggagctcctggcctcactggtccggacc
tacgtggaccgggccgaggagcaccgggagaccatgctccccggctgcacccacttccag
cccgcccagcccgtgagcctggcccaccatctgctggcctactgccagatgttcaagcgg
gaccacgagcgcgtggccgacgccctgaagcgggtgcgggtcatgccgctgggcgcggcg
gcactggccggaaccacccatcccgtggctcccgctgtggtggccgaggacctcggtttc
gaggccgtcttcgccaactccatggacgccgtcagcgaccgcgacttcgtgctggaggcc
gtgttcgacggctccctgatcatggcccacctctcgcgcatgtgcgaggagctgatcatc
tgggccaatccgaacttcggctacgtgaagctgccggaccagtattccaccggctcctcc
atcatgccccagaagaagaacccggacgcctgcgagatcatgcgcggcaagacgggcagg
gtggtcggcgacctcatggggctgctggtcctgatcaaggggctgcccatgacctacaac
cgggacatgcaggaggacaaggagccgttcttcgacgcggaccgcaccgtgtccgcctcg
ctcggcatcatggccgacatgctccggctcatggtgttcgtgccggaaaagatggcggcc
accgtcaagcgcggcttcctgaacgccaccgaactggccgactacctggccgccaagggc
gttcccttccgggaggcgcaccacatcaccggcgcggccgtggcctacgcggagaagaaa
ggcgtcgggctggaagacctggagcttacggaattgcaggaattttccggtgaaatcggg
gaagacgtctatgcggtcctcgactatcaggcggccatcgagcggcgggcgacccccggc
gggaccggcccaaaatccgtggccgcccagatcggcgcgctgaaagaatggctcggctcc
ctgtag

DBGET integrated database retrieval system