KEGG   Pseudodesulfovibrio indicus: AWY79_09890Help
Entry
AWY79_09890       CDS       T04404                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dej  Pseudodesulfovibrio indicus
Pathway
dej00040  Pentose and glucuronate interconversions
dej00052  Galactose metabolism
dej00500  Starch and sucrose metabolism
dej00520  Amino sugar and nucleotide sugar metabolism
dej01100  Metabolic pathways
dej01110  Biosynthesis of secondary metabolites
dej01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AWY79_09890
   00052 Galactose metabolism
    AWY79_09890
   00500 Starch and sucrose metabolism
    AWY79_09890
   00520 Amino sugar and nucleotide sugar metabolism
    AWY79_09890
Enzymes [BR:dej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AWY79_09890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AMK11404
UniProt: A0A126QND2
Position
2239543..2240415
Genome map
AA seq 290 aa AA seqDB search
MEIKKAVIPVAGWGTRSLPATKNVPKEMLPIFRKPIVQYIVEEGIEAGLSDVVFVTNQNK
TIIEDHFDRNFLLEQLLERAGKTTLLEEVRRVAGLVNVIGVRQKEQLGLGHAVLTAREVC
KNEPFAVMLGDDLMFGVHTGIGELIKAAKETGKAVVGVIEVPEHKVSKYGIIKGERIDQH
TYKVTELVEKPAVKDAPSNLAIIGRYVLLPEIFDILEGQRAGVGGEIQLTDALQGLADQD
KLIAVKLGGQRFDAGDWVEYLTANIYFALQDEELRDDLVKRLKELLPCSS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaagaaagcggtcattcccgtagccggatggggcacccgttccctgcccgcc
accaagaacgttcccaaggagatgctgcccatcttccgcaagcccattgtccagtacatc
gtggaggagggcatcgaggccgggttgagcgacgtggtcttcgtcaccaaccagaacaag
accatcatcgaggaccatttcgaccgcaacttcctcctggaacagctcctggagcgggcg
ggcaagaccacgctcctggaggaagtccggcgtgtggccgggctggtcaacgtcatcggc
gtgcgccagaaggagcagctcggcctgggccatgcggtgctcaccgcccgcgaggtctgc
aagaacgagcccttcgccgtcatgctcggcgacgacctgatgttcggcgtgcacaccggc
atcggcgagctgatcaaggccgccaaggagaccggcaaggccgtggtcggcgtcatcgag
gtgccggagcacaaggtcagcaagtacggcatcatcaagggtgagcgcatcgaccagcac
acctacaaggtgaccgagctggtggagaagcccgcggtcaaggacgccccgtccaacctg
gccatcatcggccggtacgtgctcctgccggagatcttcgacatcctcgaagggcagcgc
gcgggcgtgggcggcgaaatccagctgaccgacgccctccaggggctggccgaccaggac
aagctcatcgccgtgaagctcggcggccagcggttcgacgcgggcgactgggtcgagtac
ctcacggccaacatctatttcgccctgcaggacgaggagctgcgcgacgatctcgtcaag
cgcctcaaggaactgcttccctgctcgtcctaa

DBGET integrated database retrieval system