KEGG   Pseudodesulfovibrio indicus: AWY79_10005Help
Entry
AWY79_10005       CDS       T04404                                 

Definition
(GenBank) glycosyl transferase
  KO
K02844  UDP-glucose:(heptosyl)LPS alpha-1,3-glucosyltransferase [EC:2.4.1.-]
Organism
dej  Pseudodesulfovibrio indicus
Pathway
dej00540  Lipopolysaccharide biosynthesis
dej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dej00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    AWY79_10005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dej01003]
    AWY79_10005
   01005 Lipopolysaccharide biosynthesis proteins [BR:dej01005]
    AWY79_10005
Enzymes [BR:dej01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     AWY79_10005
Glycosyltransferases [BR:dej01003]
 Polysaccharide
  Bacterial polysaccharide
   AWY79_10005
Lipopolysaccharide biosynthesis proteins [BR:dej01005]
 Core region
  AWY79_10005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_1_4 Glyco_transf_4 Glycos_transf_1 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AMK11425
UniProt: A0A126QPP5
Position
2262366..2263508
Genome map
AA seq 380 aa AA seqDB search
MVKSENRARLAVTMPRLSRYGGAESFAWRLSEALAARGHAVDFICARCETDPPEGVEPVV
LGRFGAFRLVKILWFAYGAQRAQQRGNYDLVFGMGKTLNQDILRIGGGPISKFWELSRRA
WPSGFARSFKMLRRRLSPGNWAIHVIDRVRMRRTPRIVCVSHLVRDWLVEAHPFLDKEAI
DVVYNRPDLARFSPIGDQERLRLRDASAIREDQVVVATAATNFALKGVRHLVSMLTRLPE
HFVLHVAGGRNPGKYERLARELGVAHRVKFLGRVDDMPAFYRAADVFVLATFYDACSNAT
LEALACGCRSLSSAMNGSAHFLPPRWVFPDPADEGTMAEMVLRAAGEPRPGPFEWPEDVA
SGLEPYVEMVERTLAARKRS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaatctgaaaacagggcgcggctggcggtgaccatgccgagattgagccggtac
ggcggcgcggaatcctttgcctggcggctgagcgaggcgctggccgcgcgcggccacgcg
gtggacttcatctgcgcccggtgcgagaccgacccgcccgagggcgtggagccggtggtg
ctcggccggttcggcgcgttccgcctggtcaagatcctgtggttcgcctacggcgcgcag
cgggcgcagcaacgcgggaactacgacctggtcttcggcatgggcaagaccctgaaccag
gacatcctgcgcatcggcggcggtcccatctccaagttctgggagctctcccggcgcgcc
tggcccagcgggttcgcccggtccttcaagatgctccggcgcaggctctcgcccggcaac
tgggccatacatgtgatagaccgcgtccgcatgcggcgcaccccgcgcatcgtctgcgtc
tcgcacctggtgcgcgactggctggtggaggcccacccgttcctggacaaggaagccatc
gacgtggtctacaaccggcccgacctggccagattttcgcccatcggcgaccaggagcgg
ctgcggctgcgcgatgcgtccgccatccgcgaggaccaggtggtggtggccacggcggcc
accaacttcgccctcaagggcgtgcggcatctggtgtccatgctgacccggctgccggag
catttcgtgctccacgtggcgggcgggcgcaatcccggtaaatacgagcggctggcccgc
gagctgggcgtcgcccatcgggtgaagttcctgggccgggtggacgacatgcccgccttc
taccgcgccgccgacgtcttcgtgctggcgaccttctacgacgcctgctccaacgccacc
ctggaggccctggcctgcggctgccggtccctgtccagcgccatgaacggctcggcccac
ttcctgcccccgcgctgggtcttcccggacccggcggacgaggggaccatggccgagatg
gtcctgcgtgccgcgggcgagccgagacccggcccgtttgagtggcccgaggacgtcgcc
tcggggctggaaccctacgtggagatggtcgagcggacgctcgccgccaggaagcgctcc
tga

DBGET integrated database retrieval system