KEGG   Pseudodesulfovibrio indicus: AWY79_10070Help
Entry
AWY79_10070       CDS       T04404                                 

Definition
(GenBank) hypothetical protein
Organism
dej  Pseudodesulfovibrio indicus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AMK11438
UniProt: A0A126QP15
Position
2273693..2273953
Genome map
AA seq 86 aa AA seqDB search
MSQKGLGELLAKWRDNWKAWRIIFFVTLAVLVLLNVPFVTHHPHFGLDKYPGFFAGFGLI
VGLAMVIIMKKVIQPFIARKEDYYGD
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaaggtttgggcgagcttctcgccaaatggagagacaactggaaggcgtgg
aggatcatcttcttcgtcacccttgcggtcctcgtgctgctcaacgttccttttgtcacg
caccacccgcacttcgggctcgacaagtatcccgggttcttcgccggattcgggcttatc
gtgggactggccatggtcatcatcatgaagaaggtgatccagccgttcattgcgcgcaag
gaggactactatggagactag

DBGET integrated database retrieval system