KEGG   Pseudodesulfovibrio indicus: AWY79_12135Help
Entry
AWY79_12135       CDS       T04404                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
dej  Pseudodesulfovibrio indicus
Pathway
dej00260  Glycine, serine and threonine metabolism
dej00630  Glyoxylate and dicarboxylate metabolism
dej00670  One carbon pool by folate
dej01100  Metabolic pathways
dej01110  Biosynthesis of secondary metabolites
dej01130  Biosynthesis of antibiotics
dej01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AWY79_12135
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AWY79_12135
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AWY79_12135
Enzymes [BR:dej01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     AWY79_12135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AMK11809
UniProt: A0A126QPR5
Position
2686148..2687233
Genome map
AA seq 361 aa AA seqDB search
MENLATTPLTAWHRANGAKMAPFAGFDMPVQYKGIIVEHKHTREKAGIFDICHMGEFKLS
GTGAKDALNTIVSHDLNTLGAGKCRYGFLLNASGGINDDLIVYCLAEDEYMLVVNGACRE
KDFNHIKANLPDNLTFTDISDETGKIDVQGPESLAVLNDVLGGSWNHLKYFNFEQASPLG
IPMIVSRTGYTGELGFELYLPSDKVVEVWEKLAADERVEPVGLGARDTLRLEIGYPLYGQ
DLDEQRTPVEAGAGFFLKKESEYIGKSGLGRVDESLIPLSIEGRRTARHHDQVCLPDGTP
VGVVTSGSFAPSLGHCVALAYVKADAADNETFLIKTARVELEAKKVALPFYKEGTARMKI
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaacctggcaaccaccccgctcaccgcatggcacagggccaacggcgccaagatg
gccccgttcgccggtttcgacatgccggtgcagtacaagggcatcatcgtcgagcataag
cacacccgcgaaaaagcgggcattttcgatatctgccacatgggtgagttcaagctctcc
ggcacgggggccaaggacgccctgaacacgatcgtcagccacgacctgaacaccctgggc
gctggcaaatgccgctacgggttcctgctcaacgcgtccggcggcatcaacgacgacctg
atcgtctactgcctggccgaggatgaatacatgctcgtggtcaacggcgcgtgcagggaa
aaggacttcaaccacatcaaggccaacctgcccgacaatttgaccttcactgacatcagc
gacgagaccggcaagatcgacgtccagggccccgagagcctggccgtgctcaacgacgtc
cttggcggaagctggaatcacctcaaatacttcaacttcgagcaggcttccccgctcggc
atcccgatgatcgtcagccgcaccgggtacaccggcgagctgggcttcgagctgtacctg
ccctccgacaaggtggtcgaggtgtgggagaagctggccgccgacgagcgcgtggagccg
gttggactgggcgcgcgcgacaccctgcgcttggagatcggctacccgctctacggccag
gacctggacgagcagcgcaccccggttgaggcaggcgcgggcttcttcctgaaaaaggag
tccgaatacatcggcaagtccggcctgggccgggtggacgaatccctgattcccctgtcc
atcgagggccgcaggaccgcccgccatcacgaccaggtctgcctgcccgacggcaccccg
gtgggcgtggtcacctccggttccttcgccccgagcctgggccactgcgtcgccctggcc
tacgtcaaggcggacgccgcggacaacgaaaccttcctgatcaagaccgcccgcgtggag
cttgaggcgaaaaaggttgccctgcccttctacaaggaaggcaccgcccgtatgaaaatc
gactag

DBGET integrated database retrieval system