KEGG   Delftia sp. Cs1-4: DelCs14_0084Help
Entry
DelCs14_0084      CDS       T01497                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
del  Delftia sp. Cs1-4
Pathway
del00020  Citrate cycle (TCA cycle)
del00620  Pyruvate metabolism
del00650  Butanoate metabolism
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01120  Microbial metabolism in diverse environments
del01130  Biosynthesis of antibiotics
del01200  Carbon metabolism
Module
del_M00009  Citrate cycle (TCA cycle, Krebs cycle)
del_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:del00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DelCs14_0084
   00620 Pyruvate metabolism
    DelCs14_0084
   00650 Butanoate metabolism
    DelCs14_0084
Enzymes [BR:del01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     DelCs14_0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF
Motif
Other DBs
NCBI-ProteinID: AEF87126
UniProt: F6AYX0
Position
complement(88441..89955)
Genome map
AA seq 504 aa AA seqDB search
MSLADRVRFPEFLSRTMTAEQAAALIPHGVNVGMSGFTGAGYPKALPQAIAQHAKNEHAA
GRPYKINVWTGASTAAEMDGALAEAGALGQRLPFNTDPTCRARINAGEIDFIDMHLSHVA
QHAWFGFLGPMSVAVVEVLGVTEDGRLIPSTAVGNNKTWLEIADKVILEVNTKPPAKMEG
MHDIYYGTAIPPRRVPIALTHADDRIGEPYLRVDPAKVVAVVETHKGDRDNVFAQPDANS
NLIAASIIDFLAHEMKMGRLPKEMLPIQSGVGNVANAVLAGLLTGPFENLLGFTEVLQDG
MLDLLRAGKMSRASATSISLSGSAYRDFEENIDFYRERIILRPQEISNHPELVRRLGVIA
MNSMIEADIYGNINSTHVMGTGMMNGIGGSGDFARNGYLSFFVTPSVAKGGKISCIVPMC
SHVDHTEHDTQIIVTEQGLADLRGLSPRKRAQVIIDRCAHPDFRPQLQDYFDRAQRQGAL
HTPHILGEALSWHQRFVETGDMRA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcgcagaccgcgtacgtttcccagaattcctttcgcgcaccatgacggccgag
caggccgccgccctgatcccccacggcgtcaacgtcggcatgagcggattcacgggcgcg
ggctaccccaaggccctgccccaagccatcgcccagcacgccaagaacgaacacgcggcc
ggccggccctacaagatcaatgtctggaccggcgcctccacggccgccgagatggacggc
gccctggccgaggccggcgcactgggccagcgcctgcccttcaacaccgaccccacctgc
cgcgccaggatcaatgccggcgagatcgacttcatcgacatgcacctgtcccacgtggcc
cagcatgcgtggttcggcttcctgggccccatgagcgtggccgtggtcgaggtgctgggc
gtgaccgaggacgggcgcctcatcccctccaccgccgtgggcaacaacaagacctggctg
gagatcgccgacaaggtgatcctggaggtcaacaccaagccgccggccaagatggaaggc
atgcacgacatctactacggcacggccatcccgccgcgccgcgtgcccattgccctgacc
catgccgatgaccgcatcggcgagccctacctgcgcgtggacccggccaaggtggtcgcc
gtggtcgagacccacaagggcgaccgcgacaacgtcttcgcccagcccgacgccaactcc
aacctgatcgccgcgtccatcatcgacttcctcgcgcacgagatgaagatgggccgcctg
cccaaggagatgctgcccatccagtcgggcgtgggcaacgtggccaacgccgtgctggcc
ggcctgctgacggggccgttcgagaacctgctgggcttcaccgaggtgctgcaggacggc
atgctggacctgctgcgcgcaggcaagatgagccgcgcctcggccacctcgatctcgctg
tccggcagcgcctacagggacttcgaggagaacatcgacttctaccgcgagcgcatcatc
ctgcgcccccaggagatcagcaaccaccccgagctggtgcgccggctgggcgtgatcgcc
atgaactccatgatcgaggccgacatctacggcaacatcaactccacccacgtcatgggc
acggggatgatgaacggcatcggcggctcgggcgatttcgcgcgcaacggctatctgtcc
ttcttcgtcacaccctcggtggccaagggcggcaagatcagctgcatcgtgcccatgtgc
tcgcacgtggaccataccgagcacgacacgcagatcatcgtcaccgagcagggcctggcc
gacctgcgcggcctgtcgccgcgcaagcgcgcccaggtcatcatcgaccgctgcgcccat
cccgacttccgcccccagctgcaggactacttcgaccgcgcccagcgccagggcgcgctg
cacacgccgcacatcctgggcgaagcgctgagctggcaccagcgctttgtcgaaacgggc
gacatgcgcgcctga

DBGET integrated database retrieval system