KEGG   Delftia sp. Cs1-4: DelCs14_0185Help
Entry
DelCs14_0185      CDS       T01497                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
del  Delftia sp. Cs1-4
Pathway
del00010  Glycolysis / Gluconeogenesis
del00071  Fatty acid degradation
del00350  Tyrosine metabolism
del00625  Chloroalkane and chloroalkene degradation
del00626  Naphthalene degradation
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01120  Microbial metabolism in diverse environments
del01130  Biosynthesis of antibiotics
del01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DelCs14_0185
  Lipid metabolism
   00071 Fatty acid degradation
    DelCs14_0185
  Amino acid metabolism
   00350 Tyrosine metabolism
    DelCs14_0185
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DelCs14_0185
   00626 Naphthalene degradation
    DelCs14_0185
Enzymes [BR:del01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DelCs14_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 UDPG_MGDP_dh_N Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AEF87227
UniProt: F6B085
Position
208042..209172
Genome map
AA seq 376 aa AA seqDB search
MKTRAAVLTRTGAAAPYADSRPLEIWEVDLAPPGPGEVLVKVAAAGVCHSDLSIINGDRP
RDTPIVLGHEAAGVIQALGEGVTDLEVGDHVVMLFVPGCGNCQPCAEGRPVLCEPAGQAG
VAGTLLSGARRLSRNGQPISHFVGVSAFAEHAVLSRRGVHRIDKSVPLELAALFGCAVMT
GVGAVANTARVSPGQSVAVVGLGGVGLSSVMGAAAAGASRVVAVDLNADKLAMARDFGAT
DTVNAGDEDAVKQVRELTGGGVDHAFEMVGSAKALEMAYRITRRGGQTVTAGLPSSAQAI
SLPVWHLVAEERTLKGCYMGSCVPRRDIDRYLALHAAGRLPVDRLVTGHLTLDQINEGFD
RLARGEAIRQIIRMEA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaagacacgcgccgccgtactcacgagaacgggcgcagccgcgccctatgccgacagc
cgcccgctggagatctgggaggtggacctggcgccgcccggccccggcgaggtgctggtc
aaggtggccgccgcaggcgtgtgccactccgacctgtccatcatcaacggcgaccgtccg
cgcgacacgcccatcgtgctcggccatgaggccgcaggcgtgatccaggcgctgggcgag
ggcgtgaccgacctggaggtgggcgaccacgtggtcatgctcttcgtgcccggctgcggc
aactgccagccctgcgccgaaggccggccggtgctctgcgagcccgcaggccaggccggc
gtggcgggcacgctgctgtcgggtgccaggcgcctgtcgcgcaatggccagcccatctcg
cacttcgtcggcgtctcggcctttgccgagcatgccgtgctctcgcgccgcggcgtgcac
cgcatcgacaagtcggtgccgctggagctggccgcgctgttcggctgcgccgtgatgacc
ggcgtgggcgccgtggccaataccgccagggtgagccccggccagagcgtggccgtggtg
gggctgggcggcgtgggcctgtcctcggtgatgggcgcggcggcggcgggcgcgtcccgc
gtggtggccgtggacctcaatgccgacaagctggccatggcgcgcgatttcggcgccacc
gacaccgtcaatgccggcgacgaggatgccgtcaagcaggtgcgcgagctgacgggcggc
ggcgtggaccatgccttcgagatggtgggctcggccaaggcactggagatggcctaccgc
atcacgcggcgcggcggccagaccgtgacggcgggcctgccctccagcgcccaggccatc
agcctgccggtctggcacctggtggcagaggagcgcacgctcaagggctgctacatgggc
agctgcgtgccgcgccgcgacatcgaccgctacctggccctgcatgcggccggcaggctg
cccgtggaccgcctggtcaccggccacctgacgctggaccagatcaacgagggcttcgac
cgcctggcgcgtggcgaggccatacgccagatcatccgcatggaggcctga

DBGET integrated database retrieval system