KEGG   Delftia sp. Cs1-4: DelCs14_0855Help
Entry
DelCs14_0855      CDS       T01497                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
del  Delftia sp. Cs1-4
Pathway
del00860  Porphyrin and chlorophyll metabolism
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DelCs14_0855
Enzymes [BR:del01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     DelCs14_0855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 Sigma54_activat MCM AAA AAA_30 RuvB_N Sigma54_activ_2 AAA_16 AAA_3
Motif
Other DBs
NCBI-ProteinID: AEF87891
UniProt: F6ATM7
Position
966946..968091
Genome map
AA seq 381 aa AA seqDB search
MTASPDLGSGAQPALPPLFPFAAIAGQPLLCQALLLAAIDPQLGGVLIEGPRGTAKSTAA
RALAELIDAAPFVTLPLGASLEHLAGSLDLGQAMAGHALKFAPGLLARAHGGVLYVDEIN
LLPDALVDVLLDAAASGVNVVERDGISHRHAARFVLVGTMNPEEGQLRPQLLDRLGLCVR
LANVQDAAQRQAIVRARLLFDADPAAFRARHADAQAALAAQLRTARERLQPAGALPWSDA
VLQAAGALCIAAQVDGLRADLVLLRAARAWAAWLGDAEVRPDHVQAVAELVLVHRRKPGA
PQPPQQQQPSPQQAPSNPPSQSPAQSRPPAESTANGAGDSPPSEADWGAMPPEPVGLLRV
AVPSLLAREAAKAGAPATKKA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctcccctgacctgggcagcggcgcccagcccgcgctgccgccgctgtttccc
tttgccgccatcgccggccagcccctgctgtgccaggcgctgctgctggccgccatcgac
ccgcaactgggcggcgtgctgatcgaggggccgcgcggcacggccaaatccacggccgcg
cgtgcgctggccgagctcatcgatgccgcgcccttcgtcacgctgccgctgggcgcttcg
ctggagcatctggccggctcgctggacctgggccaggccatggccggccatgcgctcaaa
ttcgcgcccggcctgctggcgcgcgcccatggcggcgtgctctatgtggacgagatcaac
ctgctgcccgatgccctggtcgatgtgctgctggatgccgccgccagcggcgtcaacgtg
gtcgagcgcgacggcatctcgcaccgccacgcggcgcgcttcgtgctggtgggcaccatg
aaccccgaggaaggccaactgcgcccgcagctgctggaccgcctgggcctgtgcgtgcgc
ctggccaatgtgcaggatgcggcccagcgccaggccatcgtgcgcgcgcggctgctgttc
gatgccgacccggccgccttccgcgcccgccatgcagacgcccaggccgcgctggctgcc
cagctgcgcacggcacgcgagcgcctgcagccggccggcgcgctgccctggtccgacgcg
gtgctgcaggccgccggagcgctgtgcattgccgcccaggtggacggcctgcgggccgac
ctggtgctgctgcgcgccgcccgcgcctgggccgcctggctgggcgatgccgaggtcagg
cccgaccatgtgcaggccgtggccgagctggtgctggtgcaccgccgcaagccgggggcg
ccgcagccgccgcagcagcagcagccatccccacagcaagcgccatcgaatccgccttcg
cagtcgccggcacaaagccggccgcctgcggaatccacggccaacggcgcaggcgacagc
ccgccctccgaggccgactggggcgccatgccgcccgagcccgtgggcctgctgcgtgtc
gccgtgccctcattgctggcccgcgaggccgcaaaggcgggagcgcccgccacaaaaaaa
gcctga

DBGET integrated database retrieval system