KEGG   Delftia sp. Cs1-4: DelCs14_1178Help
Entry
DelCs14_1178      CDS       T01497                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
del  Delftia sp. Cs1-4
Pathway
del00900  Terpenoid backbone biosynthesis
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DelCs14_1178
Enzymes [BR:del01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     DelCs14_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C EF-hand_1
Motif
Other DBs
NCBI-ProteinID: AEF88210
UniProt: F6AXW4
Position
complement(1333138..1334001)
Genome map
AA seq 287 aa AA seqDB search
MRSLHDVPAPAKLNLFLHITGRRADGYHLLQSVFMLLDWHDTLHFDRRGDGQISREDLSG
MALPADDLIVRAARALQQATGCSAGVHIGVEKRLPAQAGMGGGSSDAASTLIALNRLWQL
NLTRRELQRIALDLGADVPFFLCGNSAWVEGIGERITPLEQANALPPQRFVVVKPEAGLE
TLSIFRDATLKRDHAHATIEDFAADHYGFGQNDLQPVAERLQPEVKKAIDWLNSLKLHAR
MTGSGSAVFAPLTQTIDLKDAPGAWNVRVCSNLQAHPLKDWLKDESL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcgctccacgacgtgccggctccggccaagctcaacctgttcctccacatcacc
ggccgccgcgccgatggctatcacctgctgcaatcggtcttcatgctgctggactggcat
gacacgctgcatttcgacaggcgtggcgacggccagatcagccgcgaggacctgtcgggc
atggcacttcctgccgacgatctcatcgtgcgggccgcacgggctctgcagcaggcgacc
ggctgcagcgcgggcgtgcacatcggcgtggaaaagcgcctgccggcgcaggccgggatg
ggcgggggctcgtcggatgcggcatcgaccctgatcgcactgaaccgcctgtggcagttg
aacctgacgcggcgcgagctgcagcgcattgcactggacctgggcgccgatgtgcccttc
tttctgtgcggcaactccgcctgggtggaaggcataggcgagcgcatcacgccgctggaa
caggccaatgccctgccgcctcagcggttcgtggtggtcaagcccgaggcggggctggag
accctgtccatcttccgcgacgcaaccctcaagcgcgatcatgcccatgctacaatcgaa
gactttgctgcagatcactatggctttggccaaaacgacttgcagcctgtcgccgaaagg
ctgcagcctgaagtgaaaaaagccatcgattggctaaactcactaaaactgcatgctaga
atgacgggctcaggaagtgcagtatttgcaccactgacgcaaacgattgacttaaaggat
gcccctggcgcctggaacgtcagagtttgcagcaatctgcaggcccatcctctcaaggat
tggctgaaagatgaaagtttatag

DBGET integrated database retrieval system