KEGG   Delftia sp. Cs1-4: DelCs14_1490Help
Entry
DelCs14_1490      CDS       T01497                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
del  Delftia sp. Cs1-4
Pathway
del00330  Arginine and proline metabolism
del01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DelCs14_1490
Enzymes [BR:del01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     DelCs14_1490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: AEF88522
UniProt: F6AL77
Position
complement(1686378..1687448)
Genome map
AA seq 356 aa AA seqDB search
MTLFTPDRLQALRARFGGANESVIHDPHFRAVAAHIIDASGTRNAPYAGMPTLLDAPMRP
MDWSRPDFGDLQAALIGVPMDLGISNRSGCRFGPRALRSIERVGPYNHVLRSAPTRELRV
ADIGDVPLSSRYSLEQSHRDIESAFAKIHAAGVIPLAAGGDHSITLPILRALGRERPLAL
VHFDAHCDTGGPFDGSRFHHGGPFRQAVLDGVLDPTRTIQIGIRGAAEYLWEFSYESGMT
VIHAEELPALGVDGVIARAREVVGDAPVYVSFDIDCLDPAFAPGTGTPEVGGLTVREAQA
MVRGLAGIHIVGGDVVEVSPAYDATTNTAHAGAQMMFEILGLICARHAGRGAAQPA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttttcacaccagacaggctgcaggcgctgcgcgcacgcttcggcggcgccaac
gagtccgtgatacacgacccgcatttccgcgccgtggccgcccacatcatcgatgccagc
ggcacgcgcaacgcgccctacgcagggatgcccacgctgctggacgcgcccatgcgtccc
atggactggagccgcccggattttggcgacctccaggctgcactgatcggcgtgcccatg
gacctgggcatcagcaaccgcagcggctgccgcttcggcccccgggccctgcgttccatc
gaacgcgtgggcccctacaaccatgtgcttcgatccgctcccacacgcgagctgcgcgtg
gcggacatcggcgacgtgccgctgtccagccgctacagcctggagcagtcgcaccgcgac
atagagtcggccttcgcaaagatccatgcggccggcgtgattccgctggccgctggcgga
gaccattccatcaccctgcccatattgcgcgcactgggccgcgagcggccactggccctg
gtgcatttcgacgcccactgcgacaccgggggccccttcgacggcagccgcttccaccac
ggcggcccgtttcgccaggccgtgctggacggcgtgctcgaccccacgcggaccattcag
atcggcatacgcggcgcggccgaatatctctgggagttttcctatgagtcgggcatgacc
gtgatccacgcagaggagcttcccgcgctgggcgtggacggcgtcattgcccgcgcacgc
gaggtggtgggcgatgcgcccgtctacgtctccttcgacatcgactgcctagacccggcc
tttgcgcccggcacgggcacgcccgaggtcggtggactcaccgtgcgcgaggcacaggcc
atggtgcgcggcctggccggcatccacatcgtgggcggcgatgtggtggaggtgtcgccc
gcctacgacgccaccaccaacaccgcccacgcaggcgcgcagatgatgttcgaaatcctc
ggcctgatctgcgcacgccacgccgggcgcggcgccgcccagcctgcctag

DBGET integrated database retrieval system