KEGG   Delftia sp. Cs1-4: DelCs14_1584Help
Entry
DelCs14_1584      CDS       T01497                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  diguanylate cyclase [EC:2.7.7.65]
Organism
del  Delftia sp. Cs1-4
Brite
Enzymes [BR:del01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     DelCs14_1584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF SesA Mnd1 Uds1 ABC_tran_CTD Helo_like_N Sipho_Gp157 DUF1664 DUF677 Fic Utp12
Motif
Other DBs
NCBI-ProteinID: AEF88616
UniProt: F6AN57
Position
complement(1796174..1797772)
Genome map
AA seq 532 aa AA seqDB search
MAERSASELARETLRQLALNRLPPTPENYTRLYEQAAGEPGPASFPQGPLRHVHALLPAQ
TPGQKRLRDQLGAAIERSDWQGLQQVITAYANAALQPPAHEARPVELPVPPPVQALPDDL
TQQLARRFEALSTLLDTQDTKTRQLHQQLMEQLQSPPVDAKALARRLHDQHYQLSFAIAD
QLQVLQLMQELLQTLVQHLAQDPTHGSWLVQQLTAIEQAITPPLSPAPLADARRELQTVI
HRRLQLQDGMAAAQQALRDMLGGFVQHLAQITSSNETLGARMEEAARQLDGIQRLEDAAP
LLQQVLEATRTMAAGSRVAQEELQALRAHVDACEARIETLQQELDEAARRARHDPLTGQL
NRLGVSEALDREVARAQRHGQPLSVALVDMDGMQALNAELGHAMGDAALVHVAQLARQGL
RPEDVVGRYEGQAFVLLLPQTPETAGAQALQRLLQLLEQAPLPASAQTPGQPAPRPLSFS
AGVAQLQSHENGMDVLRRADTAMLQAKERGKHCIATASGAQWQPVGNAGAGL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgctccgcttccgaactggcacgcgaaaccctgcggcaactggcgctgaac
cgcctgccgcccaccccggaaaactacacccgcctttatgaacaggcggccggcgagccc
ggccccgccagctttccccagggcccgctgcgccatgtccatgcgcttttgccagcgcag
acgcccggacagaagcgcctgcgcgaccagttgggcgccgccatagagcgcagcgactgg
caagggctgcagcaggtcatcaccgcctatgccaacgcggccctgcagccgcccgcccat
gaggcccggcccgtggagctgcccgtgccgccgcccgttcaggccctgcccgacgacctg
acccagcagttggcgcggcgcttcgaggccttgtccacgctgctggacacccaggacacc
aaaacccggcaactgcaccagcagctgatggagcagctgcaatcgccgcccgtggatgcc
aaggccctggcgcggcgcctgcacgaccagcactaccagctgtcgttcgccatcgccgac
cagcttcaggtcctgcagttgatgcaggagttgctgcagaccctggtgcagcacctggcc
caggaccccacgcatggcagctggctggtgcagcagctcacggccatcgagcaggccatc
accccgccgctgtcgcccgcgcccctggccgatgcacggcgcgagctgcagaccgtgatc
caccggcgcctgcagctgcaggacggcatggccgccgcgcagcaggcgctcagggacatg
ctgggcggcttcgtccagcacctggcgcagatcacgagcagcaacgaaacgctgggcgcc
cgcatggaagaggcggcacgccagctggacggcatccagcgcctggaagacgcagccccg
ctgctgcagcaggtgctggaggccacgcgcaccatggccgccggcagccgcgtggcccag
gaggagctgcaggcgctgcgcgcccatgtcgatgcctgcgaggcccgcatcgaaacactg
cagcaggagctggacgaggccgcgcgccgcgcacgccacgacccgctgaccggccagctc
aaccgcctgggcgtgagcgaggcactggaccgcgaggtggcacgcgcacagcgccatggc
cagccgctgagcgttgccctggtcgacatggacggcatgcaggccctcaatgccgagctg
gggcatgccatgggcgatgccgcgctggtgcatgtggcccagttggcgcgccaagggctg
cgcccggaagacgtggtgggccgctatgaaggccaggccttcgtgctgctgctgccgcag
accccggagacggcgggcgcccaggcgctgcagcgccttctgcagctgctggagcaggcg
cctttgcccgcatctgcgcagaccccaggccagcccgcaccccggcccctgagcttcagc
gcgggcgtggcccagttgcaaagccacgaaaacggcatggacgtgctgcgccgcgccgac
accgccatgctgcaggccaaggagcgcggcaagcactgcattgccacggcatcaggcgca
caatggcagccagttggaaatgcaggcgccggcctttga

DBGET integrated database retrieval system