KEGG   Delftia sp. Cs1-4: DelCs14_1760Help
Entry
DelCs14_1760      CDS       T01497                                 

Definition
(GenBank) dihydrodipicolinate synthetase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
del  Delftia sp. Cs1-4
Pathway
del00626  Naphthalene degradation
del01100  Metabolic pathways
del01120  Microbial metabolism in diverse environments
del01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:del00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    DelCs14_1760
Enzymes [BR:del01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     DelCs14_1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: AEF88788
UniProt: F6AQA2
Position
1981224..1982222
Genome map
AA seq 332 aa AA seqDB search
MGKSGLLNASDIHGVWSILPTPSKPDASDWRATNTVDLDETARAVEGLIAAGANGILSMG
TLGECESLTWEEKKVFMQTIVETARGRVPVFVGTTTLNTRDTIEQTRYAHSIGADGTMLG
IPMWCNPCVDMAVQYYKDVAEAVPEMNIAIYANTEAFKFDFPRAFWARVSEIRQVVAAKY
IGIEFLLQDLHLTKHRMKLLPLDYQYYAAARMDDFVDAFWSSGTVCGPLVSTTLRDKVIA
ARRTKDWTDAHAFQGRLVKTAAPFPEDSFKTFSIYNVALEKGRIDAAGWMNAGPVRPPYN
DICPASYLDSWKASGQRWAELHKQLETESSGK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagtcaggactgttgaatgcatcggatattcatggagtatggtcaattcttccg
acaccatccaaaccggatgcgagtgactggcgtgcgactaacaccgttgatctggatgag
actgcccgcgccgttgaaggccttatcgcggctggcgcgaacgggattctgagcatgggt
actttgggtgagtgtgaatcgctaacctgggaggaaaagaaagtcttcatgcaaaccatc
gtggagaccgcgagaggaagggttccagtgttcgttggcaccacaacgcttaatacccgc
gacacgatcgagcagacaaggtacgcccactccattggggccgacggaacaatgttggga
ataccaatgtggtgcaatccctgcgttgatatggctgttcagtactacaaagatgtcgcc
gaagctgttccagagatgaatatcgctatctacgcgaataccgaggctttcaaatttgat
tttccccgcgcgttctgggctcgggtttcagagattcggcaagtcgttgcagcgaaatat
atcggtatcgagttcctgctgcaggatctacatctgaccaagcatcgcatgaagctgctg
ccgctcgactaccaatactatgctgcggcacgtatggatgacttcgttgatgccttctgg
tccagcggtaccgtgtgcgggccattggtttcgacgacgcttcgcgacaaggtcatcgca
gctcggcgaaccaaagactggaccgatgcccacgcatttcagggtcgacttgtgaaaaca
gctgcgccatttcccgaagatagcttcaagaccttttctatttacaacgttgcgctggaa
aaaggccgaatcgatgcggcaggctggatgaacgccggccccgttcgcccaccttataac
gacatctgcccagccagctatcttgactcctggaaagcctcagggcaacggtgggccgaa
ttgcacaagcaacttgaaacggaatcttcggggaaatag

DBGET integrated database retrieval system