KEGG   Delftia sp. Cs1-4: DelCs14_3158Help
Entry
DelCs14_3158      CDS       T01497                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
del  Delftia sp. Cs1-4
Pathway
del00020  Citrate cycle (TCA cycle)
del00480  Glutathione metabolism
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01120  Microbial metabolism in diverse environments
del01130  Biosynthesis of antibiotics
del01200  Carbon metabolism
del01210  2-Oxocarboxylic acid metabolism
del01230  Biosynthesis of amino acids
Module
del_M00009  Citrate cycle (TCA cycle, Krebs cycle)
del_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:del00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DelCs14_3158
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DelCs14_3158
Enzymes [BR:del01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DelCs14_3158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH UBM
Motif
Other DBs
NCBI-ProteinID: AEF90160
UniProt: F6AT60
Position
complement(3566453..3568687)
Genome map
AA seq 744 aa AA seqDB search
MSTQQPTIIYTLTDEAPRLATSAFLPVVRAFAAPVGVNVETADISVAHRILGEFSEFLAE
DQRVAHTLSELGKKTLEPDVNIIKLPNISASVAQLTAAIKELQGKGYALPDYPENPTNDQ
EKDIKARYGKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHSMGEWKQWSQTHVSHMEH
GDFYHGEKSITLDAARDVKMELTTKSGKTVVLKSKVALKAGEIIDSMFMSKKALCDFYEK
ELDDCRDAGILFSLHVKATMMKVSHPIVFGHCVRIYYKEAFEKHGKLFDELGVNVNNGMS
TLYEKIETLPASLREEIIRDLHACQEHRPALAMVDSAKGITNFHSPNDVIVDASMPAMIR
QGGKMWGADGKPYDCKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIEEDGVANIVDLATGEVLMSQNVEQGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHEAELIKKVNTYLKDYDTTGLEIHILSQVRAMRYTLERVARGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEDLGIKNDNARAKLLAKTLDEATGKLLDEDKSPSRRTGELDNR
GSQFYIALYWAQALAAQTEDAELASKFASLAKQLADNESKIIEELRAVQGKAVDIGGYYM
PDVAKMDAVMRPSATFNAAIDALL
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcagcaacccaccatcatctacaccctgaccgatgaggctccgcgccttgcc
accagtgccttcctgcctgtggtgcgcgcctttgccgcacccgtcggcgtgaatgtcgag
accgccgacatctccgtggcccaccgcatcctgggtgagttctccgaattcctggccgaa
gaccagcgcgtggcccacaccttgtccgagctcggcaagaagacgctggagcccgatgtc
aacatcatcaagctgcccaacatcagcgcctccgtggcccagctgacggctgccatcaag
gagctgcagggcaagggctacgcactgcccgactatcccgagaatccgaccaacgatcag
gaaaaggacatcaaggcacgctacggcaagtgcctgggctcggccgtgaaccccgtgctg
cgcgagggcaactccgaccgccgcgctcctgccgccgtcaagaactacgccaagaagcac
ccccactccatgggcgagtggaagcagtggtcgcaaacccatgtctcgcacatggagcac
ggcgacttctaccacggcgaaaagtcgatcacgctggacgccgcacgcgacgtcaagatg
gagctgaccaccaagagcggcaagaccgtggtgctcaagtccaaggtggccctgaaggcc
ggcgagatcatcgactccatgttcatgagcaagaaggcgctgtgcgacttctatgaaaag
gaactggacgactgccgcgacgccggcatcctgttctcgctgcacgtcaaggccacgatg
atgaaggtctcgcaccccatcgtgttcggccactgcgtgaggatctactacaaggaagcc
ttcgagaagcacggcaagctgttcgacgagctgggcgtgaacgtcaacaacggcatgtcc
acgctgtacgagaagatcgagacgctgcccgcctcgctgcgcgaagagatcatccgtgac
ctgcacgcctgccaggaacaccgtcccgcgctggccatggtggactcggccaagggcatc
accaacttccactcgcccaacgacgtgatcgttgacgcgtccatgcccgccatgatccgc
cagggcggcaagatgtggggcgccgacggcaagccctacgactgcaaggccgtgatgcct
gagtccacatttgctcgcatctaccaggagatgatcaacttctgcaagtggcacggcaac
ttcgaccccaagaccatgggcaccgtgcccaacgtgggcctgatggcgcaaaaggccgaa
gagtacggctcgcacgacaagaccttcgagatcgaggaagacggcgttgccaacatcgtc
gatctggccaccggcgaagtgctgatgagccagaacgtggagcagggcgacatctggcgc
atgtgccaggtcaaggacgctcccatccgcgactgggtcaagctggccgtcacgcgtgcc
cgcaactccggcatgcctgccgtgttctggctggacccctatcgtccgcacgaggccgag
ctgatcaagaaggtcaacacctacctcaaggactacgacaccacgggtctggaaatccac
atcctgtcccaggtccgcgccatgcgctacacgctggagcgcgtggcccgcggcctggac
accatctcggtgaccggcaacatcctgcgcgactacctgaccgacttgttccccatcatg
gaactgggcacctcggccaagatgctgtccatcgtgcccctgatggccggcggcggcatg
tacgaaacgggtgctggcggctcggctcccaagcacgtgcagcagctggtggaggaaaac
cacctgcgctgggattcgctgggcgagttcctggcactggccgtgtcgctggaagacctg
ggcatcaagaacgacaacgcccgcgccaagctgctggccaagaccctggatgaagccacg
ggcaagctgctggacgaagacaagtcgccttcgcgccgcaccggcgagctggacaaccgt
ggcagccagttctacatcgccctgtactgggcacaggccctggcggcgcagacggaagat
gccgaactggcctccaagttcgcttcgctggccaagcaactggctgacaacgagtccaag
atcatcgaagagctgcgcgccgtgcagggcaaggccgtggacatcggtggctactacatg
cccgacgtggccaagatggatgccgtgatgcgccccagcgccacgttcaacgcagccatc
gacgcgctgctgtaa

DBGET integrated database retrieval system