KEGG   Delftia sp. Cs1-4: DelCs14_3198Help
Entry
DelCs14_3198      CDS       T01497                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
del  Delftia sp. Cs1-4
Pathway
del00071  Fatty acid degradation
del00072  Synthesis and degradation of ketone bodies
del00280  Valine, leucine and isoleucine degradation
del00310  Lysine degradation
del00362  Benzoate degradation
del00380  Tryptophan metabolism
del00620  Pyruvate metabolism
del00630  Glyoxylate and dicarboxylate metabolism
del00640  Propanoate metabolism
del00650  Butanoate metabolism
del00900  Terpenoid backbone biosynthesis
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01120  Microbial metabolism in diverse environments
del01130  Biosynthesis of antibiotics
del01200  Carbon metabolism
del01212  Fatty acid metabolism
del02020  Two-component system
Brite
KEGG Orthology (KO) [BR:del00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DelCs14_3198
   00630 Glyoxylate and dicarboxylate metabolism
    DelCs14_3198
   00640 Propanoate metabolism
    DelCs14_3198
   00650 Butanoate metabolism
    DelCs14_3198
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DelCs14_3198
   00072 Synthesis and degradation of ketone bodies
    DelCs14_3198
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DelCs14_3198
   00310 Lysine degradation
    DelCs14_3198
   00380 Tryptophan metabolism
    DelCs14_3198
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DelCs14_3198
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DelCs14_3198
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DelCs14_3198
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:del04147]
    DelCs14_3198
Enzymes [BR:del01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DelCs14_3198
Exosome [BR:del04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DelCs14_3198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEF90199
UniProt: F6AT99
Position
complement(3617425..3618606)
Genome map
AA seq 393 aa AA seqDB search
MEDIVIVSAVRTAVGKFGGTLAKIPATELGSIVIREALNRAKVGTDQVGEVIMGQVLAAG
AGQNPARQAMMKAGVAKETPALTINAVCGSGLKAVMLAAQAVATGDSEIVVAGGQENMSL
SPHVLPGSRDGQRMGDWKMADTMIVDGLWDVYNQYHMGITAENVAKEKSVSREQQDALAL
ASQQKATAAQDAGKFVDEIVPVSIPQRKGDPVVFAADEYINRKTNADALAGLRPAFDKAG
SVTAGNASGLNDGAAAVVVMSASKAKALGLTPLARIVSYATSGLDPATMGLGPVFASRKA
LERAGWTAQDVDLFELNEAFAAQACAVNQELGIDPAKVNVNGGAIAIGHPIGASGARILV
TLLHEMQRSGAKKGLAGLCIGGGMGVAMAVERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatcgtcatcgtttccgctgtccgtactgccgttggcaagtttggcggcacc
cttgccaagatccccgccaccgaactgggctccatcgtgatccgcgaggcactgaaccgc
gccaaggtcggcaccgaccaggtcggtgaagtcatcatgggccaggtgctggccgctggc
gcaggccagaacccggcacgccaggccatgatgaaggccggcgttgccaaggaaaccccg
gccctcaccatcaacgccgtctgcggctcgggcctgaaggccgtgatgctggcagcccag
gccgtggccacgggcgacagcgagatcgtcgtggccggcggccaggagaacatgagcctg
tcgccccacgtgctgccgggctcgcgcgacggccagcgcatgggcgactggaagatggcc
gacaccatgatcgtggacggcctgtgggacgtctacaaccagtaccacatgggcatcacg
gccgagaacgtggccaaggaaaagagcgtcagccgcgagcagcaggatgccctggccctg
gccagccagcaaaaggccacggccgcacaggacgcaggcaagttcgtggacgaaatcgtt
cccgtcagcattccccagcgcaagggcgatcccgtggtgttcgcggccgatgagtacatc
aaccgcaagaccaatgccgacgccctggcaggcctgcgcccggccttcgacaaggccggc
tcggtgacggccggcaacgcctcgggcctgaacgacggcgcggccgccgtggtggtgatg
agcgcctccaaggccaaggccctgggcctgacgccgctggcgcgcatcgtctcctacgcc
accagcggcctggaccccgccaccatgggcctgggcccggtgttcgcctcgcgcaaggcg
ctggagcgtgcgggctggaccgcgcaggacgtggacctgttcgagctgaacgaagccttt
gcggcccaggcctgtgcggtgaaccaggagctgggcatcgacccggccaaggtcaacgtc
aacggcggcgccattgccatcggccaccccatcggcgcatcgggcgcccgcatcctggtg
accctgctgcacgagatgcagcgcagcggcgccaagaagggcctggccggcctgtgcatc
ggcggcggcatgggcgtggccatggcggtggagcgcgtctga

DBGET integrated database retrieval system