KEGG   Delftia sp. Cs1-4: DelCs14_3782Help
Entry
DelCs14_3782      CDS       T01497                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
del  Delftia sp. Cs1-4
Pathway
del00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:del00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DelCs14_3782
Enzymes [BR:del01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DelCs14_3782
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DelCs14_3782
    1.1.1.-  
     DelCs14_3782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEF90771
UniProt: F6B251
Position
complement(4278240..4279307)
Genome map
AA seq 355 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPVVEPGTVGIEVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGAGVDDIKVGQHVVVEPYIVADDVPTGPGDHYHLSKDMNF
IGLGGRGGGLSERIAVKRRWVHPISNAIPLDQAALIEPLSVGHHAYTRSGAKAGDVALVG
GAGPIGLLLSAILKAKGLTVVITELSAKRKQKARESGVADHILDPSEVDVVAEVMKLTGG
KGVDVSFECSSVNKVLDTLVAVTKATGVVVIVSIWSHPATINVHSVVMKELDVRGTIAYC
NDHQETIKLVEEGKINLEPFITQRIQLDDLVAQGFDTLIHNNESAVKIIVQPRLR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttctacgaccggggcgacatccgcatcgaagacatccccgaaccc
gtggtggagcccggcaccgtgggcatcgaggtggcctggtgcggcatctgcggcacggat
ttgcatgagttcatggaagggccgatcttcattccgccctgcggccatccgcaccccatc
tcgggcgagtccgcacccatcaccatggggcacgagttctccggcgtggtgtacgccgtg
ggcgcgggcgtcgacgatatcaaggtcggtcagcacgtcgtggtggagccctacatcgtg
gccgacgacgtgcccacggggccgggcgaccactaccacctgtccaaggacatgaatttc
atcggcctgggcgggcgcggcggcgggctgtccgagcggattgcggtcaagcgccgctgg
gtgcacccgatctccaatgccattccactggaccaggccgcgctgatcgagccgctgtcc
gtgggccaccatgcctacacccgcagcggcgcgaaggcgggtgatgtggcgctggtcggc
ggcgcagggcccatcggcctgctgctgtccgccatcctgaaggccaagggcctgacggtg
gtcatcaccgaactgagcgccaagcgcaagcagaaggcgcgtgaatcgggcgtggccgat
cacatcctcgacccctccgaagtggacgtggtggccgaggtgatgaagctcaccggcggc
aagggcgtggatgtgtcgttcgaatgctccagcgtgaacaaggtgctggacacgctggtg
gccgtgacgaaggccacgggcgtggtggtgatcgtgtccatctggagccatccggccacc
atcaacgtgcacagcgtggtcatgaaggagctggacgtgcgcggcaccattgcctactgc
aacgaccaccaggaaaccatcaagctggtcgaggagggcaagatcaaccttgagcccttc
atcacccagcgcatccagctcgatgacctggtggcgcagggctttgacacgctgattcac
aacaacgaatcggcggtgaagatcatcgtgcagccacggctcaggtag

DBGET integrated database retrieval system