KEGG   Delftia sp. Cs1-4: DelCs14_4184Help
Entry
DelCs14_4184      CDS       T01497                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
del  Delftia sp. Cs1-4
Brite
KEGG Orthology (KO) [BR:del00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:del03016]
    DelCs14_4184
Enzymes [BR:del01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     DelCs14_4184
Transfer RNA biogenesis [BR:del03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    DelCs14_4184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 Tau95
Motif
Other DBs
NCBI-ProteinID: AEF91163
UniProt: F6AYL0
Position
4726280..4727239
Genome map
AA seq 319 aa AA seqDB search
MTGSTALPCTGVVRGGLHWRWADSAYTHALMFQPSSIPSPAQPPEPDDAPLHILWRDEHL
VAVYKPAGWLVHRTGLDAHETRFVLQTLRDQLGCHVYPAHRLDKGTCGVLVMALHAQAAQ
RLGQAFAGQEVRKQYLALVRGWLPDAVEVDHALRPDDAPEDAPAQPAQTSLRCLARLEWP
EAFDPRHAATRISLVEALPATGRRHQIRRHLKHVAHPIIGDATHGKGPLNRWWAERLGLQ
RLWLHAHALELAHPMTGEPLRFEADWRQLGHVPDVQHWRALCALPGWQACAGLPATARPD
QTASAGAPVSGCSISGAAT
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcagcactgcgttgccctgcacgggggtagtgcgcgggggcctgcattggcgg
tgggcggacagcgcctacactcacgccctcatgttccagccttcatccatcccctccccg
gcccagccgccagagcccgacgacgcgccgctgcacatcctctggcgcgacgagcatctg
gtggcggtctacaagcccgcaggctggctggtgcatcgcacgggactggacgcgcatgag
acgcgctttgtgctgcagaccctgcgcgaccaattgggctgccatgtgtaccccgcgcac
cgcctggacaagggcacctgcggcgtgctggtcatggccttgcatgcccaggccgcccag
cggctgggccaggcctttgccgggcaggaagtgcgcaagcaatacctggcgctggtgcgg
ggctggctgccggatgcggtggaggtggaccacgcgctcaggcccgacgatgcgcccgag
gacgccccagcccagcccgcacagacttcgctgcgctgcctggcgcgcctggagtggccc
gaggcctttgacccgcgccacgcggccacacggatttcactggtcgaggccctgcccgcc
acgggccggcgccaccagatacgccgccatctcaagcatgtggcccatcccatcattggc
gacgccacgcatggcaaggggccgctgaaccgctggtgggccgagcggctgggcctgcag
cggctgtggctgcacgcccatgcgctggagctggcgcacccgatgacgggcgagccgctg
cgcttcgaggccgactggcggcaactgggccatgtgcccgatgtgcagcactggcgagcg
ctgtgtgccctgcccggctggcaggcctgtgcgggcctgccggcgacggcccggccggat
cagacggcttcggcaggcgcgcccgtttcaggctgctccatcagcggcgctgccacgtag

DBGET integrated database retrieval system