KEGG   Delftia sp. Cs1-4: DelCs14_4879Help
Entry
DelCs14_4879      CDS       T01497                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
del  Delftia sp. Cs1-4
Pathway
del00010  Glycolysis / Gluconeogenesis
del00620  Pyruvate metabolism
del00640  Propanoate metabolism
del00680  Methane metabolism
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01120  Microbial metabolism in diverse environments
del01130  Biosynthesis of antibiotics
del01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DelCs14_4879
   00620 Pyruvate metabolism
    DelCs14_4879
   00640 Propanoate metabolism
    DelCs14_4879
  Energy metabolism
   00680 Methane metabolism
    DelCs14_4879
Enzymes [BR:del01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DelCs14_4879
Lipid biosynthesis proteins [BR:del01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DelCs14_4879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEF91851
UniProt: F6ASI7
Position
5485410..5487392
Genome map
AA seq 660 aa AA seqDB search
MSQDLAPSLAPSYPPSAELARNARVSGRAAYDRLVAEADADPQAFWGRLAREFVEWKHPF
TRVLDESRAPFYEWFNDGTLNASWNCLERNIQRGLGERTALIFEADDGAVTQVTYAQLLA
RVNRLANALRSLGVGKGDRVVIYMAMSIDGVAAMQACARIGAIHCVVFGGFSATALRDRI
ADTGACAVITADQQVRGGRQLPLKSIVDEALAQPGCEQVRHVLVARRTGGTIAMHPPRDL
WLEEITAAQSDVCEPEWVQAEHPLFLLYTSGSTGTPKGVQHATGGYLLHAAVTCAWTFDL
QPCDVFWCTADIGWVTGHTYIAYGPLALGATQVVFEGVPTYPDAGRFWKMIEAHGVTVFY
TAPTAIRSLIKAADADAQVHPARYDLGSLRILGSVGEPINPAAWHWYHEQVGGGRCPIVD
TFWQTETGGHMITPLPGATDLVPGSCTLAFPGIAAAVVDETGNELPWGDSGILVIKRPWP
SMIRNIWGHPERFVASYFPEEFKGRYYLAGDGAVRDARTGYFTITGRIDDVLNVSGHRMG
TMEIESALVAMTDLVAEAAVVGRPDDTTGEAICAFVVLKRSRPSGAEAADIARLLREWVA
KEIGPIAKPRDIRFGDNLPKTRSGKIMRRLLRSIARGEPIVQDTSTLENPAILEQLSQAC
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagaccttgcaccgtcccttgcaccgtcctatcccccatctgcagagctggcc
cgcaatgcgcgcgtgagcgggcgcgccgcctatgaccggctcgtcgcggaggcagacgcc
gatccccaggcgttctggggccggctcgcacgcgagttcgtcgagtggaagcacccgttc
acgcgcgtgctcgatgaaagccgcgccccgttctacgaatggttcaatgacggcacgctc
aacgccagctggaactgcttggagcgcaacatccagcgggggctgggcgagcgcacggcc
ctcatcttcgaagccgatgacggcgcggtgacgcaggtgacctatgcgcagcttctcgcc
agggtcaatcgcctggccaacgccctgcgcagcctgggcgtcggcaagggcgaccgcgtc
gtcatctacatggccatgtcgattgacggcgtggccgccatgcaggcctgtgcacgcata
ggcgccattcactgcgtggtgttcggcggcttctccgccacggcgctgcgcgaccgcatt
gcggacacgggggcctgcgccgtcatcacggcagaccagcaagtgcggggaggacggcaa
ttgcccctcaagagcatcgtggacgaggccctggcccagcccggctgcgagcaggtccgc
cacgtgctggtggcacggcgcacgggcggcaccatcgccatgcacccgccccgggacctg
tggcttgaagaaatcaccgcagcccagagcgatgtctgcgaaccggaatgggtgcaggcc
gagcatccgctgtttctgctctacacctcgggctccaccggaacccccaagggcgtccag
cacgccaccggaggctatctgctgcatgccgccgtgacctgcgcctggaccttcgacctg
cagccctgcgatgtcttctggtgtacggcggacatcggatgggtgaccggccatacctat
atcgcctacggcccgctggcgctgggcgccacgcaggtggtgttcgagggcgtgcccacc
tacccggacgcgggacgcttctggaaaatgatcgaggcccacggggtgacggtcttctac
acggcgcccacggccattcgctcgctgatcaaggcggccgacgccgatgcgcaggtgcat
cccgcgcgctacgacctgggcagcctgcgcatcctggggtccgtgggcgagccgatcaat
cccgccgcctggcactggtaccacgagcaggtgggcgggggccgctgccccatcgtcgat
acgttctggcagacggagacgggcgggcacatgatcacgccgctgcccggagccacggac
ctggtgcccggctcctgcacgctggccttcccgggcattgccgccgccgtggtggacgag
accggcaacgagctgccctggggcgacagcggcatcctggtgatcaagcgcccctggccc
tccatgatcaggaacatctggggccatcccgagcggtttgtcgccagctactttcccgaa
gaattcaagggccgctactacctggcgggagacggcgcggttcgcgatgcgcgcaccggc
tacttcaccatcaccggccgcatcgacgatgtgctcaacgtcagcggccaccgcatgggc
acgatggagatcgagtccgccctggtggccatgaccgacctggtggcggaggccgccgtc
gtggggcggcccgatgacacaacaggagaggccatatgcgccttcgtcgtcctcaagcgt
tcgcggcccagcggcgccgaggcggcagacatcgcccggctgctgcgggagtgggtggcc
aaggagatcgggccgatcgccaagcccagggacatccggttcggagacaacctgcccaag
acccgcagcggcaagatcatgcggcgattgctgcgcagcattgcacgcggcgagcccatc
gtgcaggacacctccaccctggagaacccggcgatcctggagcagctgtcacaggcctgc
tga

DBGET integrated database retrieval system