KEGG   Candidatus Doolittlea endobia: MHIR_DE00052Help
Entry
MHIR_DE00052      CDS       T04480                                 

Gene name
metG_1
Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
den  Candidatus Doolittlea endobia
Pathway
den00450  Selenocompound metabolism
den00970  Aminoacyl-tRNA biosynthesis
den01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:den00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MHIR_DE00052 (metG_1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MHIR_DE00052 (metG_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:den01007]
    MHIR_DE00052 (metG_1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:den03016]
    MHIR_DE00052 (metG_1)
Enzymes [BR:den01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MHIR_DE00052 (metG_1)
Amino acid related enzymes [BR:den01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MHIR_DE00052 (metG_1)
Transfer RNA biogenesis [BR:den03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MHIR_DE00052 (metG_1)
 Prokaryotic type
   Other AARSs
    MHIR_DE00052 (metG_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CUX96415
UniProt: A0A143WRP1
Position
I:57423..59111
Genome map
AA seq 562 aa AA seqDB search
MKAYLTMTQFTKKMLVTCALPYANGSIHLGHMLEHIQADIWVRYQRMRGHQVYFICADDA
HGTPIMLKAQQLGVAPEEMVNAINLEHKRDFAGFGISYDNYYLTHSEENRQLSTLIYQRL
KDNGFIESRIISQLFDPEKGMFLPDRFVKGGCPKCHSPDQYGDNCEVCGATYNPTDLINP
KSSVSGVTPIIRKSEHFFLNLSAFSEMLRSWTHSGALQKQVANKMQEWFESGLQQWDISR
DAPYFGFEIPDAPGKYFYVWLDAPIGYMSAFQNLCQKRSDLRFDEFWNVDSKADLYHFIG
KDIVYFHSLFWPAMLEGSHFRKPTNLFVHGYVTVNGAKMAKSRGTFIKASTYLAHLDADC
LRYYYATKLSSRIDDIDLNLKDFVHRINADIVNKVVNLASRNAGFINKCFDGKLSGSVAD
PALYIIFVNAAMSIGEAFSNREISRAVREIMALADLANRYVDEQAPWVVAKQESRKADLQ
VICSMGIQLFRVLMTYLKPVLPFLAERAEAFLATSLHWNDLSSPLLSHRIQPFKVLLSRV
KTSQVEAVIEASFRRQAAGVSS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctatttaactatgactcaattcacaaaaaaaatgttggtaacttgtgcgtta
ccttacgctaacggttccatccatcttggtcatatgctcgagcatattcaggcggatatt
tgggtccgttatcaacgaatgcgcggccatcaggtctattttatttgtgctgatgatgct
cacgggacgccaatcatgcttaaagcgcagcagttgggtgttgcgccggaagagatggtc
aacgcaataaacctggagcataaaagggactttgctggatttggtattagctacgataac
tactatttaacccatagcgaagagaatcgacagctatcgaccttgatttaccaacgtcta
aaagataatggatttattgaatcgaggatcatttcccaactatttgatcctgaaaagggc
atgtttttgccagaccgctttgtgaaaggcggttgcccgaaatgccactcacctgatcaa
tacggcgataattgtgaagtttgtggcgccacctataacccaacggatctaattaatccg
aaatcgtcagtgtcgggcgttacgccgatcatacgaaagtcagagcacttttttcttaac
ttatccgctttcagtgaaatgttacgttcctggacgcattccggtgcgctgcaaaagcag
gtggctaacaagatgcaagagtggttcgaatctgggttgcagcagtgggatatttcccgc
gatgcgccttactttggctttgaaataccagatgcgccaggcaaatatttttatgtatgg
ctggatgcgcctatcggatacatgagcgcattccaaaacctgtgccagaaacgcagtgat
ctccgctttgacgaattttggaatgtggattccaaagccgacctttatcattttatcggt
aaggacatcgtgtattttcacagcctcttctggcctgcgatgcttgaaggtagtcacttt
cgaaaaccaactaatttgtttgtacatggttatgtaaccgtcaacggcgctaaaatggct
aaatcacgtggcactttcatcaaagctagtacctatctagcgcatttagatgcagactgt
ttgcgttattactatgcaactaaactatcgtctcgcatcgatgatatcgaccttaatctc
aaagatttcgtccataggatcaatgccgatatcgtcaataaagtcgttaatctagcctcg
cgcaacgccggatttatcaataaatgctttgacggcaagctatcggggtcagtagctgac
ccagcattatatattattttcgttaatgctgcaatgtctataggcgaggcgttcagcaat
cgtgaaatcagccgcgcagttcgagaaatcatggcattagcagatttggcaaatcgctat
gtcgatgagcaagcaccttgggtcgtggcaaaacaggaaagccgaaaggcggatttgcag
gttatctgttcgatgggcatccagctgttccgagtattgatgacttatttaaaaccagtt
ctaccttttttggcagagcgagctgaagcctttcttgctacctcacttcactggaacgat
ctatcatctccgctgctgtcgcatcgcatacaaccgtttaaggtgctgctcagtcgcgtt
aaaacatcccaggtagaggctgtgattgaagcatcgtttcgacggcaagctgctggggtc
agtagctga

DBGET integrated database retrieval system