KEGG   Desulfobulbus oralis: CAY53_02905Help
Entry
CAY53_02905       CDS       T05339                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
deo  Desulfobulbus oralis
Pathway
deo00020  Citrate cycle (TCA cycle)
deo00640  Propanoate metabolism
deo00660  C5-Branched dibasic acid metabolism
deo01100  Metabolic pathways
deo01110  Biosynthesis of secondary metabolites
deo01120  Microbial metabolism in diverse environments
deo01130  Biosynthesis of antibiotics
deo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:deo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAY53_02905
   00640 Propanoate metabolism
    CAY53_02905
   00660 C5-Branched dibasic acid metabolism
    CAY53_02905
Enzymes [BR:deo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CAY53_02905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: AVD70557
UniProt: A0A2L1GLR7
Position
complement(677662..678543)
Genome map
AA seq 293 aa AA seqDB search
MSIFADKNTRLLVQGITGSEGMFHTRKCIEYGTKVVAGVTPGKGGQKMDDVPVFNTVREA
RKASGANASMIFVPPRFAADSIMEAIDAGIELVVCITEGIPILDMMKVKNYLLTRPQTRL
IGPNCPGLLTPGACKIGIMPASIVKPGGPWGVVSRSGTLTYEAVNQLTLAGFGQTTCIGI
GGDPINGTSFIDCLKEFKKDPETKAVVMIGEIGGNAEEDAYEWIKENMPDKPVVGFIAGL
TAPPGRRMGHAGAIVSGGKGTAAAKIEAMKRCGIHHCQNLGKLGELCKQVYKV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcattttcgctgacaagaatacccgtttgctcgtccagggcatcaccggctcggag
ggcatgttccatacccgcaagtgcattgaatacggcaccaaggtcgtagcaggcgtaacg
cccggaaaaggcggccagaagatggacgatgtgccggttttcaacaccgtgcgcgaggcc
agaaaggccagcggcgccaacgcctccatgatcttcgtaccgccgcgctttgccgccgac
tccatcatggaagccattgacgcaggcatcgagctggtggtctgcatcacggaaggcatt
ccgatactggacatgatgaaggtcaaaaactacctgctgacccgtccgcagactcgcctg
atcggccccaactgcccgggcctgctgaccccgggcgcctgcaaaatcggcatcatgccg
gcctccatcgtcaagcctggcggcccctggggcgttgtctcccgctccggaacgctgact
tacgaggcggtcaatcagctcaccctggccggctttggccagaccacctgcatcggcatc
ggcggcgatcccatcaacggcaccagctttattgactgcctgaaggagttcaaaaaggat
cccgagaccaaggctgtggtcatgattggcgagatcggcggcaatgccgaggaagacgcc
tacgaatggatcaaggaaaatatgccggacaagccggtggtcggcttcattgccggcctc
accgcgcctccaggccgccgtatggggcatgcgggcgccattgtcagcggcggcaagggc
acggcggctgccaagatcgaggccatgaagcgctgcggcatccatcattgccagaacctg
ggcaaactgggcgagctgtgcaagcaggtttataaggtctga

DBGET integrated database retrieval system