KEGG   Desulfobulbus sp. ORNL: CAY53_05105Help
Entry
CAY53_05105       CDS       T05339                                 

Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
deo  Desulfobulbus sp. ORNL
Pathway
deo00450  Selenocompound metabolism
deo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:deo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CAY53_05105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:deo03016]
    CAY53_05105
Enzymes [BR:deo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CAY53_05105
Transfer RNA biogenesis [BR:deo03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CAY53_05105
 Prokaryotic Type
    CAY53_05105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AVD70935
UniProt: A0A2L1GMM2
Position
1156340..1157407
Genome map
AA seq 355 aa AA seqDB search
MSNKKIRLTGAVRAAGUAAKLGPGSLGQLLSGLKVPADPRLLVGLATGDDAGVYLLNSET
ALIQTVDFFTPMVDEPFAFGRIAAANALSDVYAMGGRPLLCMNLLCCPTGSMEDTVFREI
LEGGLDAIGEAGALLVGGHSVEDAELKYGLSVTGVVQPERLLTNAGARPGDVLLLTKPLG
CGVLATALKGGLLPEAAEAALIRAMATLNRAPIAVLEGMPEELRAEVHACTDVTGFGLIG
HAHEMAAASKTSLHIASAEVPLLPEALEMAGMGMIPAGAYRNRNHYRSVLHSTLPEDGVA
AMLAFDPQTSGGLLLALSAAAAEALLLGLEAAGYGQPAALIGRVEATAAGRIFLE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaagaagatccgtctgaccggcgctgtcagggcagccggctgagcggccaaa
ctgggtccggggtcactgggccaattgctttccgggctgaaggtgcccgctgatccccgc
ctgctggtcggtctggccactggcgacgacgccggagtctaccttttgaacagcgagacc
gcgctgattcagaccgtggattttttcacgcccatggtggacgagccctttgccttcggc
cggattgccgcggccaacgcgctctcggacgtctacgccatgggcggcaggccgcttttg
tgcatgaatctcctgtgctgtcctacaggcagcatggaggacacggtttttcgggaaatt
ctggaaggcgggctggatgcgatcggcgaggctggagcgctcctggtgggggggcattcc
gtggaggatgcggagctgaagtacgggctgtctgtgaccggggtggtgcagccggagcgg
cttttgaccaatgcgggcgcccgtcccggggatgtgctgcttttgaccaagccgcttggg
tgcggcgttctggccacggcgctgaaaggcggtctgctgccggaagctgccgaggccgcc
ctgatccgggccatggccacgctgaaccgtgcgccgattgcggttctggaggggatgccg
gaagaactccgggcggaggtgcacgcctgcaccgatgtcacgggcttcggcctgatcggc
catgcccacgaaatggccgcagcctcgaagacgagtctgcatatcgcaagcgcggaggtg
ccgcttttgccggaggcgctcgagatggcgggcatgggcatgattccggccggcgcctat
cgcaaccggaaccattaccgctctgtcctgcactcgacgctgcctgaagatggggtggcc
gccatgctggcctttgacccgcaaacatcaggcggcctgctgctggcgctctcggctgct
gccgcggaagcgctgcttttggggctcgaggcagcgggctatggccagcctgccgccctg
atcggcagggtggaggcgacagccgcaggccgcatctttctggagtga

DBGET integrated database retrieval system