KEGG   Devosia sp. H5989: XM25_08380Help
Entry
XM25_08380        CDS       T04003                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
deq  Devosia sp. H5989
Pathway
deq00071  Fatty acid degradation
deq00072  Synthesis and degradation of ketone bodies
deq00280  Valine, leucine and isoleucine degradation
deq00310  Lysine degradation
deq00362  Benzoate degradation
deq00380  Tryptophan metabolism
deq00620  Pyruvate metabolism
deq00630  Glyoxylate and dicarboxylate metabolism
deq00640  Propanoate metabolism
deq00650  Butanoate metabolism
deq00900  Terpenoid backbone biosynthesis
deq01100  Metabolic pathways
deq01110  Biosynthesis of secondary metabolites
deq01120  Microbial metabolism in diverse environments
deq01130  Biosynthesis of antibiotics
deq01200  Carbon metabolism
deq01212  Fatty acid metabolism
deq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:deq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XM25_08380
   00630 Glyoxylate and dicarboxylate metabolism
    XM25_08380
   00640 Propanoate metabolism
    XM25_08380
   00650 Butanoate metabolism
    XM25_08380
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XM25_08380
   00072 Synthesis and degradation of ketone bodies
    XM25_08380
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XM25_08380
   00310 Lysine degradation
    XM25_08380
   00380 Tryptophan metabolism
    XM25_08380
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XM25_08380
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XM25_08380
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XM25_08380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:deq04147]
    XM25_08380
Enzymes [BR:deq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XM25_08380
Exosome [BR:deq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XM25_08380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKR55815
UniProt: A0A0K0TVN6
Position
complement(1747882..1749063)
Genome map
AA seq 393 aa AA seqDB search
MSLPSVVIVSARRTPIGSLGGVLSPLPAHELGAVAIRAALADARVEADAIDETILGQVLT
AGAGMNPARQAARKAGLPDAAPAALVNQVCGSGLRAVAMASQQIATGVAHIVVTGGQESM
SCAPHVVSLRKGTKLGDMTLRDTVMSDGLSDAFYGYPMGSTAENVAMRYQISRDRQDAFA
LASQHKASAASTSGRFDEEIVPVEVPVRKGAVEVRADEHIRHDASIEIMEKLRPAFREDG
TVTAGNASGINDGAAALVLMSEDEARRRGLEPLARIASWAHAGVDPQVMGIGPVPASRRA
LERAGWDIADVDLWEVNEAFAAQSLAVLSDLEIDPERVNVNGGAIALGHPIGASGARILT
TLVHEMRRRQSKRGVATLCIGGGMGIAMAVEHV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgccctccgtcgtaatcgtctccgctcgccgcacacccatcgggtcgctggga
ggcgtgctttcgccgctgcccgcgcatgagttgggcgcggtcgccattcgagccgcactt
gccgatgcgcgcgtggaggcggacgcgatcgacgagaccatccttggccaggtgctgacg
gccggcgccggtatgaacccggcccggcaggctgcccgcaaggcgggcctgcccgatgcg
gcgcccgccgcgctcgtcaaccaggtctgcgggtcggggctgcgggcggtggcaatggcc
agccagcagatagcaaccggcgtcgcgcacatcgttgtcacgggcgggcaggagagcatg
agttgcgcgccgcacgtggtatcgctgcgcaaggggaccaagctcggcgacatgactctg
cgcgacaccgtgatgagcgatgggctctccgatgctttttacggctatcccatgggctcg
actgccgagaacgtcgccatgcgctaccagatcagccgcgaccggcaggacgcctttgcc
ctcgcgtcccagcacaaggcctccgcggcttcgacgtccggccgtttcgatgaggagatc
gtcccggtcgaggtgcccgtccgcaagggcgcggtcgaggtgcgggccgacgagcacatc
cggcacgacgccagtatcgagatcatggaaaagctccggccggccttccgcgaggacgga
acggtcaccgccggcaatgcctcgggtatcaacgacggcgcggcggcgctggttctcatg
agcgaggatgaagctcggaggcgggggttggagccgctggcgcgcatagcctcgtgggca
cacgcgggtgtcgatccacaggtcatgggcatagggccggtccctgccagccgccgcgcg
ctcgagcgtgccggctgggacatcgccgacgtggacctctgggaggtgaacgaggcgttc
gcggcgcaaagccttgcggtgctctccgacctcgagatcgatccggagcgggtgaatgtc
aacggaggggccatcgctcttggtcaccccatcggggcgtcgggcgcccgcatcctcact
acgctcgttcacgaaatgcgccggcgccagtcgaagcgcggtgttgcgaccctgtgcatc
ggaggcggcatgggcatcgccatggcggtcgagcatgtctga

DBGET integrated database retrieval system