KEGG   Devosia sp. H5989: XM25_09565Help
Entry
XM25_09565        CDS       T04003                                 

Gene name
L22
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
deq  Devosia sp. H5989
Pathway
deq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:deq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    XM25_09565 (L22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:deq03011]
    XM25_09565 (L22)
Ribosome [BR:deq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    XM25_09565 (L22)
  Bacteria
    XM25_09565 (L22)
  Archaea
    XM25_09565 (L22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AKR56043
UniProt: A0A0K0TWB9
Position
complement(1979549..1979929)
Genome map
AA seq 126 aa AA seqDB search
MGKQKTPRALKDNEAKAVLRMLRISPQKLNLVAAMIRGKKVEKALAELQFSHKRIAGQVK
KVLESAIANAENNHGLDTDALVVAEAFVGNSLVMKRWTARGRGRSSRIEKPFSHLTIVVR
QVEEAA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcagaagactccccgcgcgctcaaggataacgaggccaaggccgttctgcgg
atgctgcgcatcagcccgcagaagctgaacctggttgccgcgatgatccgcggcaagaag
gtcgagaaggctcttgccgagctgcagttctcgcacaagcgcattgccggccaggtcaag
aaggtgctcgagagcgccatcgcgaacgcggaaaacaatcatggtctggacaccgacgct
ctggtcgttgccgaggccttcgtcggcaactcgctggtgatgaagcgctggaccgctcgc
ggtcgtggtcgctcctcgcgcatcgaaaagccgttctcgcacctgacgatcgtcgtgcgg
caagttgaggaagcggcataa

DBGET integrated database retrieval system