KEGG   Devosia sp. H5989: XM25_10555Help
Entry
XM25_10555        CDS       T04003                                 

Definition
(GenBank) siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
deq  Devosia sp. H5989
Pathway
deq00860  Porphyrin and chlorophyll metabolism
deq01100  Metabolic pathways
deq01110  Biosynthesis of secondary metabolites
deq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:deq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XM25_10555
Enzymes [BR:deq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     XM25_10555
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     XM25_10555
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     XM25_10555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 Sirohm_synth_M CysG_dimeriser Pyr_redox_3 PcrB
Motif
Other DBs
NCBI-ProteinID: AKR56229
UniProt: A0A0K0TWX3
Position
complement(2158859..2160247)
Genome map
AA seq 462 aa AA seqDB search
MGALNTFPLSYKVQGQRIVIVGGGEEALNKARLAVKTTAQVVIIATQVEADFSGHDVTLV
ERAFRPSDLDGAALVFVADHGADAEAAIAAARTRNIPLNVVDVPAECDFYTPSIVERAPL
TIAISSEGDAPVLARLIRARIEAMLSPRLGAIARLAGSLRERVAATLGKAEARRFYEDLV
TSPTIERAVEAGQGASAAAALLDAHAQTASKGVVWLIGAGPGSEDLLTLRAQRLLQEADV
IVHDQLVPQVVVDMGRRDAERIQVGKAKGNHTFSQAQINTLIVRLAGQGKKVARLKSGDP
MIFGRAGEEVAALRKAGLDYVIVPGVTAALAAAADTATPVTLRKVSSGFVMATAHGADDG
DLHHWAALAASGMTVALYMGKSNAAEVARSFIKHAASVHLPVGIVANAGRAERSLYRGTL
GELAAGAADFADGPAIIFVGEAVAHGDWADAASVAIEEYKVA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcactcaacacatttccgttgagctacaaagttcagggtcagcgcatcgtcatc
gtcggcggtggagaagaagccctcaacaaagcccggttggcagttaagactaccgctcaa
gtcgtgattatcgcaacgcaggtcgaggccgacttctccggtcacgacgtgacgctggtc
gagcgggccttccgcccctccgatctcgatggcgccgcgctggtgttcgtggccgatcac
ggcgccgatgccgaggctgccatcgccgccgcccggacccgcaacattccactcaacgtc
gtcgacgttccggccgagtgcgatttctacacgccctcgatcgtggagcgcgcgccgctc
accatcgccatctcctcggaaggcgatgcgcccgtgctggcgcgtctcatccgcgcccgc
atcgaggccatgctgtcgccgcgcctgggcgccatcgcccggcttgccggttcgctgcgc
gagcgggttgccgcgacgctcggcaaggccgaggcccggcggttttacgaagacctcgtc
acctcgccgaccatcgaacgcgccgtcgaggccgggcagggcgcttcggccgctgccgcg
cttctcgatgctcacgcgcagacggcgagcaagggcgtcgtctggctgatcggagccggg
ccgggctcggaggatcttctcaccctgcgcgcccagcgtctgctgcaggaggccgacgtc
atcgttcacgaccagcttgtgccgcaggtggtggtcgacatggggcgtcgcgatgccgag
cgcatccaggtcggcaaggccaagggcaatcacacgttcagccaggcgcagatcaatacg
ctcatcgtccgcctggccgggcagggcaagaaggtggcgcgcctcaagtcgggcgatccg
atgatcttcggccgggccggcgaggaagtcgccgcgctgcgcaaggctggcctcgactac
gtcatcgtgcccggcgtcaccgccgcgcttgccgctgccgccgacacggcgacgccggtg
acgctgcgcaaggtttcgagcgggttcgtgatggcgacggcgcacggggctgacgatggc
gatctgcatcactgggcggcgctcgccgcctccgggatgaccgtggcgctctacatgggc
aagagcaacgccgccgaggtggcgcgctcgttcataaagcatgcggcgtccgttcatctg
ccggtcggaattgtggccaatgccggccgggcagagcgttcgctctatcgcgggacgctg
ggggaactggcggcgggagccgccgatttcgccgacggacctgcaatcattttcgtgggc
gaggcggtggcgcatggcgattgggccgatgccgcatccgtcgcgatcgaggaatacaag
gtagcctga

DBGET integrated database retrieval system