KEGG   Devosia sp. H5989: XM25_13330Help
Entry
XM25_13330        CDS       T04003                                 

Definition
(GenBank) FAD-binding monooxygenase
  KO
K05712  3-(3-hydroxy-phenyl)propionate hydroxylase [EC:1.14.13.127]
Organism
deq  Devosia sp. H5989
Pathway
deq00360  Phenylalanine metabolism
deq01100  Metabolic pathways
deq01120  Microbial metabolism in diverse environments
deq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:deq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    XM25_13330
Enzymes [BR:deq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.127  3-(3-hydroxyphenyl)propanoate hydroxylase
     XM25_13330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Peptidase_U32 Pyr_redox HI0933_like NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AKR56758
UniProt: A0A0K0TYE4
Position
complement(2723993..2725546)
Genome map
AA seq 517 aa AA seqDB search
MKPVLVVGAGPVGLMTALALKFYGIEFRSFEEDNAFSSDTKAGTILTRTVEAFRRYGVDK
AVLSKALRLDEIGEIERATNQRRASVMTENLFDETRFPFVLNIPQHHLEPILAEGLEDLP
EGWVNLKHKLIDFTQNEDGVVARFETPEGIKEVEGSYLLACDGGRSTVRTQLGIEVEGVS
LDVRYMLVDIKVDLDKANPRDYPYLAYFADPAEWMILVRQPHCWRFLFPLAPGAEEATRE
ELEAKVRHFVGDVTSLEVLNTVIYRVHHRIASKWRNDRVFLMGDAAHLITPMWALGLNTG
VLDAINLPWRLAWVLRGWADDSLLNGYEREQQPLAAHGSGEMAEAARKLMGGETGEAKAM
SGTDWANAMTRSLLGVKVDAEGAGDWSIVKTERTALRVGDRIADMPVFDGQGGRKYLHDL
CDDSFAALYFTDVRRRPDIPADTLPGLRSYVVSRWDAPLDSGLRDRALLDIGNKVRDKLG
LGEDVVVLLRPDDHVAAILPMASADIEGLYKTIIGRK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagttctggttgtcggggcgggtccggtgggtctgatgaccgcgctggcgctc
aaattctacggcatcgaattccgctcgttcgaggaagacaatgccttctcgtccgacacc
aaggccggtacgatcctgacgcgcacggtggaagccttccgccgctatggcgtggacaag
gcagtgctctccaaggccctgcgcctggacgagatcggcgagatcgagcgcgccaccaac
cagcgtcgcgcttcggtcatgaccgagaacctgtttgacgagacgcggtttccgttcgtc
ctcaacattccccagcaccacctcgagccgatcctggccgagggcctggaagacctgccg
gaaggctgggtcaacctcaagcacaagctgatcgacttcacccagaacgaggatggcgtc
gtcgcccgcttcgagacgcccgagggcatcaaggaagtcgagggctcttatcttctcgcc
tgcgacggcggccgctcgacggtgcgcacgcagctcgggatcgaggtcgagggcgtgtcg
ctcgacgtgcgctacatgctggtcgacatcaaggtcgacctcgacaaggccaatccgcgc
gactacccgtacctggcctatttcgccgatccggcggagtggatgatcctggtgcggcag
ccgcattgctggcggttcctgttcccgctggcgccgggggccgaagaggccacgcgcgag
gagctggaggccaaggtgcgccatttcgtgggcgacgtgacctcgctcgaagtgctcaat
accgtcatctatcgcgtccatcaccgcatcgcttccaagtggcgcaacgaccgcgtgttc
ctgatgggcgatgccgcacacctcatcaccccgatgtgggcgctggggctcaataccggc
gtgctcgacgccatcaacctgccgtggcgcctggcatgggtgctgcgcggctgggccgat
gacagcctgctcaacggctacgagcgcgagcagcagccgctggccgcgcacggctcgggc
gaaatggcggaagcggcgcgcaagctcatgggcggagagaccggcgaggccaaggccatg
tcgggcaccgactgggccaacgccatgacccgctcgctgctgggcgtgaaggtcgatgcc
gagggcgccggggactggtcgatcgtcaagaccgagcgcacggcgctgcgcgtcggcgac
cgcatcgccgacatgccggtgttcgacgggcagggcgggcggaaatatctccacgacctg
tgcgatgacagttttgcggcgctctatttcaccgacgtgcgccgtcgccccgatattccg
gccgacacgctgccggggctcaggagctacgtggtttcgcgctgggacgcgccgctggat
tcggggctgcgcgaccgtgcgctgctcgatatcggcaacaaggtccgcgacaagctgggc
ctgggcgaagacgtcgtggtgctgctgcgcccggacgaccatgtggcggcgatcctgccc
atggccagcgccgacatcgaaggcctctacaagaccattatcgggcggaagtga

DBGET integrated database retrieval system