KEGG   Devosia sp. H5989: XM25_14095Help
Entry
XM25_14095        CDS       T04003                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
deq  Devosia sp. H5989
Pathway
deq00520  Amino sugar and nucleotide sugar metabolism
deq01100  Metabolic pathways
deq01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:deq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XM25_14095
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    XM25_14095
Enzymes [BR:deq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XM25_14095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AKR56902
UniProt: A0A0K0TYN6
Position
2883117..2884142
Genome map
AA seq 341 aa AA seqDB search
MPSTTPLALFVGMPGLELSASEIAFFREANPFGLFLFKRNLDNPDQIRRLCAQFREAVGR
EDAPVYIDQEGGRVQRLDNGNWPIFRSLGSFGALARKDLELGKRAMRLSSLAMGTMMAQL
AIGSGTTPVVDLARKGTHDVIGQRSFGDDPDLVIAMAREVIEAMLEVGEMPIVKHIPGYG
RVTVDPHFDCPIVDASVEDMRETDFRPFAALRDAPWAMVAHLIFTQVDPEHPASVSPAVC
ELIRRDIGFDGVIVTDCLTMEALKGTWPERVKAALDAGYDIALHSQGDLAASEAAARAAR
PLTDESLARISRAQARLGTRRVDVNAVHAEVEQIFRENGFA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgaccacgccactcgcccttttcgtcggcatgccgggcctcgagctctccgcc
tccgagatcgcctttttccgcgaggccaatcccttcgggctcttcctcttcaagcgcaac
ctggacaatcccgaccagatccggcgcctctgcgcccagttccgcgaggcggtcgggcgc
gaggatgcgccggtctatatcgaccaggaaggcggccgcgtgcagcggctcgataacggc
aactggccgatcttccgcagcctgggcagcttcggcgcccttgcccgcaaggacctcgag
ctcggcaagcgcgccatgcgcctctcctcgctcgccatgggcaccatgatggcgcagctc
gccatcggcagcggcaccacgcccgtcgtcgacctagcgcgcaagggcacccatgacgtc
atcggccagcgctcgttcggggacgatccggaccttgtcatcgccatggcccgcgaggtg
atcgaagccatgctcgaagtcggcgagatgccgatcgtcaagcatattcccggttacggc
cgcgtcacggtcgatccccatttcgattgtcccatcgtcgacgccagcgtcgaggacatg
cgcgagaccgacttcaggcccttcgccgccctcagggacgcaccctgggccatggtcgcg
cacctgatcttcacgcaggtcgacccggaacacccggcttccgtgtcgcccgccgtgtgc
gagctcatccgccgtgacattggctttgatggcgtcatcgtcaccgattgcctcaccatg
gaagcgctcaagggcacctggcccgaacgcgtcaaggccgcgctcgatgccggctacgac
atcgcgctccacagccagggcgatctcgccgccagcgaagccgccgccagggcggcgcgg
ccgctcaccgacgagagcctggcacgaatttcccgcgcccaggcccggctcggaacccga
cgcgtggacgtcaatgccgtccatgccgaggtcgaacagattttcagggagaacggcttc
gcctga

DBGET integrated database retrieval system