KEGG   Devosia sp. H5989: XM25_16135Help
Entry
XM25_16135        CDS       T04003                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
deq  Devosia sp. H5989
Pathway
deq00051  Fructose and mannose metabolism
deq01100  Metabolic pathways
deq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:deq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    XM25_16135
Enzymes [BR:deq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     XM25_16135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MAAL_C MR_MLE_N PepSY
Motif
Other DBs
NCBI-ProteinID: AKR57281
UniProt: A0A0K0U008
Position
complement(3284309..3285583)
Genome map
AA seq 424 aa AA seqDB search
MTKITGLKTFDLRFPTSQSLDGSDAMNPDPDYSAAYVVLDTDGPHEGHGLTFTIGRGNEV
VCAAIRALEGRVTGLDLDWIAENPGRFWRHVTGDSQLRWIGPDKGAMHLATGAVVNAVWD
LLAKDAGKPVWQFVADMTPEQLVSIVDFRYLTDAITPEEALEIFRKAEAGKAERIERLKA
EGYPCYTTSAGWLGYSNEKLTRLATEAVDAGFNHIKMKVGRDLDDDIRRLEIVRSIMGPD
RYLMIDANQVWEVDQAIDWVRELKRFNPYFIEEPTSPDDIEGHRKIREAIAPVRVATGEM
CQNRIIFKQFITRGAIDIVQIDACRIGGLNEVLSVLLMAAKYKLPVWPHAGGVGLCEYVQ
HLSMIDYLVVSGTKEGRVIEFVDHLHEHFIEPCDIRNAAYMPPTLPGFSIQMKPESILEH
VFEG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagattaccggcctcaagacctttgacctgcgctttccgacctcccagtcgctg
gacgggtcggacgccatgaaccccgatcccgactattcggcggcctatgtggtgctcgac
accgacggtccgcacgaggggcacgggctgaccttcaccatcgggcgcggcaacgaagtg
gtgtgcgcggctatcagggcgctcgagggccgggtgacagggctcgacctcgactggatc
gccgaaaacccgggccgcttctggcggcatgtgaccggcgacagccagctgcgctggatc
ggcccggacaagggcgcgatgcacctggccaccggcgccgtcgtcaacgcggtctgggat
ctgctcgccaaggatgcgggcaagcccgtctggcagttcgtcgccgacatgacgcccgag
caattggtctcgatcgtcgacttccgctacctcaccgatgccatcacccccgaggaggcc
ctcgaaatcttccgcaaggcggaagccggcaaggccgagcgcatcgaaaggctcaaggcc
gagggctatccctgctacaccacctcggcgggctggctgggctattcgaacgagaagctg
acgcgcctcgccaccgaggcggtggacgccgggttcaaccacatcaagatgaaggtcggg
cgcgacctcgacgacgacatccgcaggctcgaaatcgtgcgctccatcatggggccggac
cgctacctgatgatcgacgccaaccaggtgtgggaagtcgaccaggccatcgactgggtg
cgcgaactcaagcgcttcaacccctatttcatcgaggagccgaccagccccgacgatatc
gagggccaccgcaagatccgcgaagccatcgcccctgtacgggtggcgaccggcgaaatg
tgccagaaccgcatcatcttcaagcagttcatcacccgtggcgctatcgacatcgtccag
atcgacgcctgccgcatcggggggctcaacgaagtgctctcggtgctgctgatggcggcc
aagtacaagctcccggtctggccgcatgcgggcggcgtcggcctttgcgaatacgtccag
cacctctcgatgatcgattatctggtcgtttcggggaccaaagaggggcgcgtgatcgag
ttcgtggaccatctccacgagcacttcatcgaaccctgcgacatccgcaacgccgcctac
atgccgcccacgctgccgggcttctccatccagatgaagcccgaatcgatcctcgagcac
gtgttcgaagggtaa

DBGET integrated database retrieval system