KEGG   Drosophila erecta: 6542093Help
Entry
6542093           CDS       T01060                                 

Definition
(RefSeq) aminomethyltransferase, mitochondrial
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
der  Drosophila erecta
Pathway
der00260  Glycine, serine and threonine metabolism
der00630  Glyoxylate and dicarboxylate metabolism
der00670  One carbon pool by folate
der01100  Metabolic pathways
der01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    6542093
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    6542093
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    6542093
Enzymes [BR:der01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     6542093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-GeneID: 6542093
NCBI-ProteinID: XP_001969934
FlyBase: FBgn0115807
UniProt: B3N548
Position
Unknown
AA seq 405 aa AA seqDB search
MFRLSYRLPTALGGLRHASSAAGEGQRTALYDFHVQRGGKIVNFGGYALPVQYSDQSIIA
SHLHTRQVGSIFDVSHMLQTRVFGKDAAACLESICTADILGTPEGSGGLTVFTNEAGGIL
DDLIVNKVSEKELYVVSNAAMKEQDMGIMSAAVDNFKSQGKDVTIEFLTPTDQSLVAVQG
PQVAKELSKLLAKEAALDQLYFMSSLVTSFAGIPNVRITRCGYTGEDGVEISVESGQAQR
LTESLLESGVLKLAGLGARDSLRLEAGLCLYGSDIDAKTTPVEAALAWLVSKRRRTTRDF
PGADVILGQLKEGVSRRRVGLQMLGTKPPPARSGVAIISQGQQVGQVTSGCPSPSAGRNI
AMGYVPENLKAPGTKVELKVRDKLYEAEVTKMPFVKANYYNRPKK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgttcagactaagctatcgactgcccaccgccctcggcggtctgcgccacgcctcctcc
gctgccggcgagggtcagcgcaccgccctctacgatttccacgtgcagaggggcggcaag
atcgtgaacttcggcggctacgccctgccggttcagtattcggatcagagcattatagcc
tcccacctgcacacccgccaggtgggctccatcttcgacgtgtcgcacatgctgcagact
cgggttttcggcaaggatgcggccgcctgtctggagtccatttgcacagcggacattttg
ggcactccggagggcagtggtggcctcaccgtcttcaccaacgaggcgggcggcatcctg
gacgatcttatcgtgaacaaagtcagcgaaaaggagctgtatgtggtctccaatgcggcg
atgaaggaacaggacatgggcataatgagtgcagcagtggacaactttaagtcccagggc
aaagatgtaacaattgaattcctcacacccaccgatcagtccctagttgccgtccagggc
cctcaggtggcaaaggagctatcgaaactacttgccaaggaagctgctctggatcagctc
tactttatgagttccctcgtcaccagctttgctggaatacccaatgtccggatcacgaga
tgtggctacaccggggaggacggtgtggaaatatcggtggaatctggccaggcacagagg
ctcacagaatcccttctcgagagtggagtcctcaagcttgctggtctgggcgccagagac
tccctgcgattggaggcgggtctctgcctgtatggcagtgatatcgatgccaaaacaaca
cccgtggaggcggctctggcctggttggtatccaaaagacgccgcaccacccgagacttt
ccaggagctgatgtgatcctcggccagctgaaggagggcgtcagccgcaggcgggtgggt
ctccagatgctgggtaccaagccaccgccagctcgttccggagtggccatcattagccag
ggtcagcaggtgggtcaggtgaccagtggctgcccaagtcctagtgctggacgcaacatt
gctatgggatacgtaccggagaacctaaaggcacctggcacaaaggtggagctcaaggtt
cgagacaagctctacgaagccgaagtcaccaaaatgccttttgtaaaagcaaactattat
aacaggccaaagaaataa

DBGET integrated database retrieval system